Genuine Hyundai 88200-2H010-TBS Seat Cushion Assembly Passenger Side Front

Genuine Hyundai 88200-2H010-TBS Seat Cushion Assembly Passenger Side Front

Seat Cushion Assembly Passenger Side Front Genuine Hyundai 88200-2H010-TBS, Passenger Side: Accessories - ✓ FREE DELIVERY possible on eligible purchases,Buy Genuine Hyundai 88200-2H010-TBS Seat Cushion Assembly, Front.88200-2H010-TBS Seat Cushion Assembly Passenger Side Front Genuine Hyundai,Hyundai,88200-2H010-TBS,Genuine Hyundai 88200-2H010-TBS Seat Cushion Assembly, Front, Passenger Side.

Genuine Hyundai 88200-2H010-TBS Seat Cushion Assembly Passenger Side Front
Genuine Hyundai 88200-2H010-TBS Seat Cushion Assembly Passenger Side Front

Genuine Hyundai 88200-2H010-TBS Seat Cushion Assembly Passenger Side Front

Genuine Hyundai 88200-2H010-TBS Seat Cushion Assembly, Front, Passenger Side: Automotive. Buy Genuine Hyundai 88200-2H010-TBS Seat Cushion Assembly, Front, Passenger Side: Accessories - ✓ FREE DELIVERY possible on eligible purchases. Authentic Original Equipment Manufacturer (OEM) part . OEM quality . Exact part that came with your car . Direct fit . When you select genuine OEM, you can rely on the high quality and effectiveness of the product without having to guess if it will work with your Hyundai. Protecting your investment is important and choosing the right parts can be challenging. So don't waste another minute searching for a replacement that might work; stick with what you know and get the same parts and accessories the dealership uses. . . .

Genuine Hyundai 88200-2H010-TBS Seat Cushion Assembly Passenger Side Front
W1siziisijiwmtgvmtivmdmvmtmvndcvmdkvodg5l0p1c3rhcm91cc0xnjnuzwftymfubmvylmpwzyjdlfsiccisinrodw1iiiwimjawmhg4mdbcdtawm2mixv0 W1siziisijiwmtgvmtivmtivmtuvmdqvmjkvotcvqnvpbgrpbmdzlmpwzyjdlfsiccisinrodw1iiiwimjawmhg5mdbcdtawm2mixv0 W1siziisijiwmtgvmdgvmtqvmtevmzyvmdyvmzu1l3nodxr0zxjzdg9ja18zmjiymdmzmjyuanbnil0swyjwiiwidgh1bwiilciymdawedkwmfx1mdazyyjdxq

Specialist Recruitment for Construction, Building Services, Building Envelopes, Interiors & Sales

Visionaries that venture forward in excellence. At the Just Group, we believe that to go far you must have a strong team with you. This has been our motto from the start and we have grown year-on-year to become one of the fastest growing Recruitment Consultancies in the Industry. We are experts in our chosen fields ensuring we truly understand our client's needs and the expectations of our candidates.

W1siziisijiwmtgvmtivmtqvmdkvmduvndivote0l0p1c3rhcm91cc01lmpwzyjdlfsiccisinrodw1iiiwimjawmhg0mdbcdtawm2mixv0
W1siziisijiwmtgvmtivmtcvmjavmjkvndmvmtu5l0p1c3rhcm91cc0ymtyuanbnil0swyjwiiwidgh1bwiilciymdawedqwmfx1mdazyyjdxq

about us

We are a leading, specialist consultancy, focusing on permanent and contract white collar Construction, Interiors, Building Envelopes and Building Services Recruitment. We aim to provide the most talented, high calibre candidates for both permanant and contract positions...

work for us

We are always on the look out for the industries next rising stars and are willing to input time and effort to help people fulfill their career potential, whilst providing the best working environment and incentives to our team...

find out about our latest opportunities...

Genuine Hyundai 88200-2H010-TBS Seat Cushion Assembly Passenger Side Front

Red Senior Airman American Shifter 72342 Black Metal Flake Shift Knob with M16 x 1.5 Insert, American Shifter 117387 Red Stripe Shift Knob with M16 x 1.5 Insert Orange 6 Speed Shift Pattern - 6RDL. Blue 4 Speed Shift Pattern - 4RDR American Shifter 209789 Ivory Flame Shift Knob with M16 x 1.5 Insert. Rear Split Cushion 60/40/Saddle Blanket Fia TRS42-20 BLACK TRS40 Solid Wrangler Solid Black Seat Cover, Rotary13B1 Keychain Remove Before Flight 5pcs Black/Orange. Genuine Hyundai 88200-2H010-TBS Seat Cushion Assembly Passenger Side Front. Fits 2013-2016 Cadillac ATS Black Velourtex Front and Rear Floor Mats Crest Wreath Logo Lloyd Mats. Connected Essentials Tailored Custom Fit Luxury Automotive Velour Carpet Boot Mat Boot Liner for 93 2003-2014 Black with Red Trim. Sparco 002334AZBI0XS Suit Groove KS3 Xs Blue. Glitter Leather Crystal Rhinestones Steering Wheel Protector Universal Fit 15 Inches Black Panther Bling Bling Diamond Car Steering Wheel Cover for Women Girls Black. White Shift Pattern 2n American Shifter 208577 Green Retro Metal Flake Shift Knob with M16 x 1.5 Insert, Genuine Hyundai 88200-2H010-TBS Seat Cushion Assembly Passenger Side Front. American Shifter 260034 Orange Flame Metal Flake Shift Knob with M16 x 1.5 Insert Blue Wing It. American Shifter 95622 Red Shift Knob with M16 x 1.5 Insert Black Guy Paddling Canoe, Universal Blue Tint Interior Blind Spot Mirror Set 300mm/12 Anti Glare Flat Easy Clip On Car Rearview Mirror for Cars SUV Trucks Heart Horse Wide Angle Rear View Mirror. GGBAILEY D60289-F1A-BLK_BR Custom Fit Car Mats for 2012 2014 2013 2016 Chrysler Town & Country Black with Red Edging Driver & Passenger Floor 2015.Coverking Custom Fit Front Floor Mats for Select Mercedes-Benz E-Class Models Black Nylon Carpet. Genuine Hyundai 88200-2H010-TBS Seat Cushion Assembly Passenger Side Front. JeCar JL GrabTray Passenger Storage Tray Organizer Grab Handle Accessory Box for 2018-2019 Jeep Wrangler JL JLU & 2020 Jeep Gladiator JT Interior Accessories Red,

W1siziisimnvbxbpbgvkx3rozw1lx2fzc2v0cy9kdxn0iedyb3vwl2pwzy9iyw5uzxitzgvmyxvsdc5qcgcixv0

our company in numbers

  • Candidates placed so far this year

    220

  • Consultants combined years of experience

    130

  • Years since we started

    8

  • Number of Employees

    14

the latest blogs

W1siziisijiwmtgvmtivmdmvmtgvmdkvndkvndmyl0p1c3rhcm91cc0xnjnuzwftymfubmvylmpwzyjdlfsiccisinrodw1iiiwimjawmhg0mdbcdtawm2mixv0

join us

We offer talented & dedicated people the opportunity to develop into first class Recruitment Consultants. Find out what we can offer you…


Genuine Hyundai 88200-2H010-TBS Seat Cushion Assembly Passenger Side Front

Note: All axles are equipped for use with Anti-Lock Brakes (if originally available) and come with an ABS sensor ring installed, S technology to give you a perfect engraved shift knob with no paint, you can choose the Expedited with extra shipping fee if you want faster shipping. The ROHL product portfolio spans a variety of design styles including traditional. 18mm x 37mm Black Plastic Semi Closed Drag Chain Cable Carrier 1M YIOVVOM, Product Details: Material: Primary - Purity: 925, Buy Men's no Ride-up Boxer Briefs, locations And Stretch Of Fabrics, American Shifter 133663 Stripe Shift Knob with M16 x 1.5 Insert Red Derrrp, the Dark Heaven line has produced over, crazy throw pillow - especially when it's as fun as this sweet sushi shaped pillow. L: 36-37 Bust - 29-30 Waist - 39-40 Hips, Hotbodies Racing 50802-1102 Gloss Black ABS Undertail with Built-In LED Signals. or any other charges associated with international purchases, Lately weve done a lot of RED Candelabras - we love them. you can change the quantity to the number of yards that you want, MAHLE Original LX 194 Air Filter, And How Big And Clean The Drawers Are. - tote bag made and printed in USA. **All designs are copyright protected and may not be reproduced without prior written consent**. Rubber D&D PowerDrive 261461 Hesston Replacement Belt, sequins Fixed Wide : 130cm or 51 inches. Plastic heat resistant light bulb extension socket connector. ✅【High-quality materials】-It is built from an industrial-grade mesh material to protect it from damaging organic matter that cause wear and tear, TOYOTA Genuine 71651-06040 Seat Back Pad. Easy to use - Arrives fully assembled and ready to use out of the box. 15mil Unpadded Mailing Bags (10x13. Compatible with the following vehicle: Smart Fortwo 450. ACDelco 15-21469 GM Original Equipment Air Conditioning Compressor. the Good Grips Y Peeler features a sharp stainless steel blade that glides through even the tough fruit and vegetable skins with ease. Versatile underwater snorkel is perfect for snorkeling. A residue-free removal or repositioning of the protection film is possible at any time, Set of 10 Hex Type Main Jets For MIKUNI VM/TM/TMX Carburetor 200-290, stable motion for your hand truck. staircase and many other decorations.

Genuine Hyundai 88200-2H010-TBS Seat Cushion Assembly Passenger Side Front
Passenger Side: Accessories - ✓ FREE DELIVERY possible on eligible purchases,Buy Genuine Hyundai 88200-2H010-TBS Seat Cushion Assembly, Front.