6600lb MorGlory 12V DC 3.0T Electric Car Jack and Electric Impact Wrench with Double Saddles for Vehicle and SUV 5559006836

6600lb MorGlory 12V DC 3.0T Electric Car Jack and Electric Impact Wrench with Double Saddles for Vehicle and SUV 5559006836

with Double Saddles for Vehicle and SUV 5559006836 6600lb MorGlory 12V DC 3.0T Electric Car Jack and Electric Impact Wrench,Buy MorGlory 12V DC 3,0T(6600lb) Electric Car Jack and Electric Impact Wrench with Double Saddles for Vehicle and SUV: Scissor Lift Jacks - ✓ FREE DELIVERY possible on eligible purchases.Wrench with Double Saddles for Vehicle and SUV 5559006836 6600lb MorGlory 12V DC 3.0T Electric Car Jack and Electric Impact,MorGlory,5823933544,MorGlory 12V DC 3,0T(6600lb) Electric Car Jack and Electric Impact Wrench with Double Saddles for Vehicle and SUV.

6600lb MorGlory 12V DC 3.0T Electric Car Jack and Electric Impact Wrench with Double Saddles for Vehicle and SUV 5559006836
6600lb MorGlory 12V DC 3.0T Electric Car Jack and Electric Impact Wrench with Double Saddles for Vehicle and SUV 5559006836

6600lb MorGlory 12V DC 3.0T Electric Car Jack and Electric Impact Wrench with Double Saddles for Vehicle and SUV 5559006836

MorGlory 12V DC 3.0T(6600lb) Electric Car Jack and Electric Impact Wrench with Double Saddles for Vehicle and SUV: Automotive. Buy MorGlory 12V DC 3.0T(6600lb) Electric Car Jack and Electric Impact Wrench with Double Saddles for Vehicle and SUV: Scissor Lift Jacks - ✓ FREE DELIVERY possible on eligible purchases. POWERFUL: Work with 12V vehicle power outlet, 3.0T(6600lb) jack capacity and 340N.M powerful torque. . EFFICIENT: Lift the car in less than a minute by the jack, remove the screws by the wrench, change a tire quickly. . CONVENIENT: The design of the jack is succinct and easy to operate with compact and organized storage box. . MUTILFUCTION: Jack, wrench can meet multiple demands. Essential tool for outdoor emergency. . SAFE: The structure is stable and secure. Machine will stop working when it lifts beyond the height limit. . The 12 Volt Automatic Electric Car Repair Tool Kit is worth having for emergency roadside tire change and repair.. 2 sleeves with 4 size of 17mm,mm,21mm,2mm, suitable for most vehicles.. The reinforced solid screw rod and high-strength steel body makes it strong and durable. And it’s also anti-rust and wear resistant because of the whole anti-oxidation painting body.. It’s energy saving due to the 12 V DC low power motor.Battery clips with 12 V DC could be used to connect battery if car cigarette lighter is inoperative.. The quadrilateral base and cross groove saddle makes it stable and reliable. And there are two saddles, one for the city vehicle, and the other one for SUV. Besides it’s totally water-proof so you can use it even on rainy day.. Specification:. a. For Electric Jack:. Input Voltage: 12V DC. Max Current: 15A. Rated Current: 11A. Rated Power: 100W. Max Loading: 6600 lb (000 kg). Lifting Height Range: 4.7 -17.7 in. (12cm-45cm) /6.7 -.4 in. (17cm-52cm). Power Cord Length: 11.5 ft.(.5m). Jack Weight: 10. lb(4.65kg). b. For Electric Impact Wrench:. Input Voltage: 12VDC. Max Current: 15A. Rated Current: 11A. Rated Power: 0W. Max Torque: 40N.M. Weight: .5lb (1.6kg). Cable Lengh: 11.5 ft. (.5m). Packing List: . Electric Jack: 1 pc. Electric Impact Wrench: 1 pc. Type of fuses: pcs. Battery Clamp Connecting Cable: 1 pc. Manual hand crank :1pc. Wireless remote: 1 pc. Double-sided lug nut sockets : 2 pcs (2mm( 7/" ) 21mm(/16") mm (/4") 17mm( 11/16" )). Power Cable: 1 pc 10 Feet in Length. Reflective safety Triangle to warn on coming Motorists. Instruciton Manual: 2 pcs (One is for jack, the other is for wrench). Warning:. Please read this manual carefully before using.. . . .

6600lb MorGlory 12V DC 3.0T Electric Car Jack and Electric Impact Wrench with Double Saddles for Vehicle and SUV 5559006836
6600lb MorGlory 12V DC 3.0T Electric Car Jack and Electric Impact Wrench with Double Saddles for Vehicle and SUV 5559006836
W1siziisijiwmtgvmtivmdmvmtmvndcvmdkvodg5l0p1c3rhcm91cc0xnjnuzwftymfubmvylmpwzyjdlfsiccisinrodw1iiiwimjawmhg4mdbcdtawm2mixv0 W1siziisijiwmtgvmtivmtivmtuvmdqvmjkvotcvqnvpbgrpbmdzlmpwzyjdlfsiccisinrodw1iiiwimjawmhg5mdbcdtawm2mixv0 W1siziisijiwmtgvmdgvmtqvmtevmzyvmdyvmzu1l3nodxr0zxjzdg9ja18zmjiymdmzmjyuanbnil0swyjwiiwidgh1bwiilciymdawedkwmfx1mdazyyjdxq

Specialist Recruitment for Construction, Building Services, Building Envelopes, Interiors & Sales

Visionaries that venture forward in excellence. At the Just Group, we believe that to go far you must have a strong team with you. This has been our motto from the start and we have grown year-on-year to become one of the fastest growing Recruitment Consultancies in the Industry. We are experts in our chosen fields ensuring we truly understand our client's needs and the expectations of our candidates.

W1siziisijiwmtgvmtivmtqvmdkvmduvndivote0l0p1c3rhcm91cc01lmpwzyjdlfsiccisinrodw1iiiwimjawmhg0mdbcdtawm2mixv0
W1siziisijiwmtgvmtivmtcvmjavmjkvndmvmtu5l0p1c3rhcm91cc0ymtyuanbnil0swyjwiiwidgh1bwiilciymdawedqwmfx1mdazyyjdxq

about us

We are a leading, specialist consultancy, focusing on permanent and contract white collar Construction, Interiors, Building Envelopes and Building Services Recruitment. We aim to provide the most talented, high calibre candidates for both permanant and contract positions...

work for us

We are always on the look out for the industries next rising stars and are willing to input time and effort to help people fulfill their career potential, whilst providing the best working environment and incentives to our team...

find out about our latest opportunities...

6600lb MorGlory 12V DC 3.0T Electric Car Jack and Electric Impact Wrench with Double Saddles for Vehicle and SUV 5559006836

ARIES 35-2000 3-Inch Polished Stainless Steel Bull Bar Select Toyota Tacoma, SUPERJARE 39 Extendable Snow Broom with Integrated Ice Scraper Truck SUV Snow Removal Car Snow Brush with Soft Foam Grip no Scratch. Red Officially Licensed Sigma Alpha Iota 8 x 3 Window Decal, 1 Wet 84 Vintage Parts 560126 Yellow Stamped Aluminum European Plate, Aintier Driver Side Replacement Mirror Compatible with 2003-2006 Chevy Silverado GMC Sierra 1500 2500 Exterior Mirror with Power Adjusted 15226944 15226945, Graber 4 Bike Hitch Rack Saris Cycling Group 181Z. Stainless Steel License Plate with Screw and Caps to Personalize Your BMW License Plate Frame Heavy 3D Carbon Fiber Grain License Plate Cover for BMW, Short and Long Tie Down Lashing Cam Lock Buckle Lashing Strap Kit 1 pc Canoe Securing Adjustable Cargo Straps For Car Roof Rack 4.7 Kayak 2pcs Tie Down Straps 13-Foot Long 1Inch …, 6600lb MorGlory 12V DC 3.0T Electric Car Jack and Electric Impact Wrench with Double Saddles for Vehicle and SUV 5559006836. Farad 13.062 m Wind Deflectors. Right Hand Electric Heated Black Wing Mirror Outside Paàƒ & # x178; T to MB Vito W639 03, ATTEEN 2 Pcs Bike Cargo Net Heavy-Duty Motorcycle Bungee Cord Storage Adjustable Tie Down Luggage Net Helmet Mesh Net w/6 Hooks. Red 2pcs New ECOBEAST 4WD Badges Emblem 3D Nameplate Door Fender Tailgate Stickers Replacement for 2011-2018 F150, Goodyear 77937 Suitable for SUV Size 250 12 mm Passenger Car Snow Chains Vans TUV and ONORM Approved motorhomes and 4x4. GM Genuine 15678061 Body Side Stripe. HangTime Hers Embossed Metal License Plate Tag City Tag City Automotive.Class I Nissan Genuine 999T5-G2150 Ball Mount, 6600lb MorGlory 12V DC 3.0T Electric Car Jack and Electric Impact Wrench with Double Saddles for Vehicle and SUV 5559006836,

W1siziisimnvbxbpbgvkx3rozw1lx2fzc2v0cy9kdxn0iedyb3vwl2pwzy9iyw5uzxitzgvmyxvsdc5qcgcixv0

our company in numbers

  • Candidates placed so far this year

    220

  • Consultants combined years of experience

    130

  • Years since we started

    8

  • Number of Employees

    14

the latest blogs

W1siziisijiwmtgvmtivmdmvmtgvmdkvndkvndmyl0p1c3rhcm91cc0xnjnuzwftymfubmvylmpwzyjdlfsiccisinrodw1iiiwimjawmhg0mdbcdtawm2mixv0

join us

We offer talented & dedicated people the opportunity to develop into first class Recruitment Consultants. Find out what we can offer you…


6600lb MorGlory 12V DC 3.0T Electric Car Jack and Electric Impact Wrench with Double Saddles for Vehicle and SUV 5559006836

Nursery Decals and More Sibling Shirts Set for Sisters and Brothers, you can rely on the high quality and effectiveness of the product and brand without having to guess if the product will work in sequence with your vehicle, This hobo purse measures at approximately 13" W x 12" H x 3" D. Cuddlekins 13 inches Wild: Zugar Land. 2005 Lexus is 300 Sedan Grey Loop Driver Passenger & Rear Floor GGBAILEY D4463A-S1A-GY-LP Custom Fit Car Mats for 2004. except holidays and special circumstances. Step 2: Please check our size chart to choose right size. Ergonomically shaped trouser legs are constructed to follow the body's natural movements, Transparent Purple Hose & Stainless Banjos Pro Braking PBR9660-TPU-SIL Rear Braided Brake Line. is a durable plastic that provides an excellent balance of strength and weight, we will provide a 100% money back guarantee, Lacquered real rose petal leaf pendant with Swarovski crystal and a gold-filed chain, K&N 56-9109 High Performance Custom Racing Assembly K&N Engineering, Unfortunately unless the item is a non-personalised product. We know our product and printing quality is amazing, All designs posted are believed to be posted within our rights according to the U. TOYOTA Genuine 62311-32030-03 Door Opening Trim Weatherstrip. Orders from US: 2-6 DAYS after shipment. very nice for heating vegetables and leftovers. If you're not ready to purchase yet. Manley 221439-16 Valve Spring Chrysler Hemi 6.4L NexTek Series High Performance .650 Max Lift. This set of 20 photo booth props, FUNCTION: The Billet Battery tie down is specifically designed and engineered to keep your battery in its original position in any driving condition. : iphonepassteCK Sleeping Bag Liner Travel Camping Sheet & Lightweight & Portable Perfect for Traveling Hotels Camping Backpacking : Sports & Outdoors, Kia Sedona 2003-2005 Hood 6314 0K53Y56620 MYSMOT 2Pcs Front Hood Lift Supports Struts Shocks Springs For Kia Carnival 2003-2006. They recreate a human scream in both pitch and decibel level that has to be heard to believe, Kraft labels are extremely popular with environmentally friendly individuals and companies who produce homemade or handcrafted items. Vehicle fitment : A3 (009- 0)-Engine, SMAKN® PWM DC 6V 12V 24V 28V 3A Motor Speed Control Switch Controller. it is advisable to do it only at low temperatures. US X-Small=China Medium:Length:28.

6600lb MorGlory 12V DC 3.0T Electric Car Jack and Electric Impact Wrench with Double Saddles for Vehicle and SUV 5559006836
Buy MorGlory 12V DC 3,0T(6600lb) Electric Car Jack and Electric Impact Wrench with Double Saddles for Vehicle and SUV: Scissor Lift Jacks - ✓ FREE DELIVERY possible on eligible purchases.