Glass Keys Whiteboards Mirrors Viaky 8 Pack Reusable Sticky Gel Car Mount Holder Mat Non-Slip Cell Phone Pad Washable Anti-Slip Auto Cell Pads Holders for Car Dashboard Metal Black&Clear

Glass Keys Whiteboards Mirrors Viaky 8 Pack Reusable Sticky Gel Car Mount Holder Mat Non-Slip Cell Phone Pad Washable Anti-Slip Auto Cell Pads Holders for Car Dashboard Metal Black&Clear

Holder Mat Non-Slip Cell Phone Pad Washable Anti-Slip Auto Cell Pads Holders for Car Dashboard Metal Black&Clear Glass Keys Whiteboards Mirrors Viaky 8 Pack Reusable Sticky Gel Car Mount, Metal, Keys(Black&Clear): Cradles - ✓ FREE DELIVERY possible on eligible purchases,Buy Non-Slip Cell Phone Pad, Viaky 8 Pack Reusable Sticky Gel Car Mount Holder Mat, Washable Anti-Slip Auto Cell Pads Holders for Car Dashboard, Glass, Mirrors, Whiteboards.Mount Holder Mat Non-Slip Cell Phone Pad Washable Anti-Slip Auto Cell Pads Holders for Car Dashboard Metal Black&Clear Glass Keys Whiteboards Mirrors Viaky 8 Pack Reusable Sticky Gel Car, Washable Anti-Slip Auto Cell Pads Holders for Car Dashboard, Glass, Mirrors, Whiteboards, Metal, Keys(Black&Clear),viaky,Non-Slip Cell Phone Pad, Viaky 8 Pack Reusable Sticky Gel Car Mount Holder Mat.

Glass Keys Whiteboards Mirrors Viaky 8 Pack Reusable Sticky Gel Car Mount Holder Mat Non-Slip Cell Phone Pad Washable Anti-Slip Auto Cell Pads Holders for Car Dashboard Metal Black/&Clear
Glass Keys Whiteboards Mirrors Viaky 8 Pack Reusable Sticky Gel Car Mount Holder Mat Non-Slip Cell Phone Pad Washable Anti-Slip Auto Cell Pads Holders for Car Dashboard Metal Black/&Clear

Glass Keys Whiteboards Mirrors Viaky 8 Pack Reusable Sticky Gel Car Mount Holder Mat Non-Slip Cell Phone Pad Washable Anti-Slip Auto Cell Pads Holders for Car Dashboard Metal Black&Clear

Non-Slip Cell Phone Pad, Viaky 8 Pack Reusable Sticky Gel Car Mount Holder Mat, Washable Anti-Slip Auto Cell Pads Holders for Car Dashboard, Glass, Mirrors, Whiteboards, Metal, Keys(Black&Clear). Buy Non-Slip Cell Phone Pad, Viaky 8 Pack Reusable Sticky Gel Car Mount Holder Mat, Washable Anti-Slip Auto Cell Pads Holders for Car Dashboard, Glass, Mirrors, Whiteboards, Metal, Keys(Black&Clear): Cradles - ✓ FREE DELIVERY possible on eligible purchases. 【Strong Sticky Gel Pad】Made from safe & environmental PU nano rubber.Odorless, non-polluting, non-toxic.Fixate gel pads can be repeated washing, easy to remove and no harm for wall or cell phone, leave no trace or residue on the surface after removing. . 【Durable And Reusable】Just wash the sticky gel mat with water, dry it and it is ready for use again. *NOTE* Dust or dirt will reduce its fixation effect.Other factor that affects the stickiness of gel pad holder is the surface type and shape of the object which you want to stick. . 【Multi Usage】 You can apply it to your car, kitchen, toilet, cupboard, desk and many other places to hold things like remote control, camera, phone, keys, mirror, pad and so on.Free paste, random removal, freely to carry, freely to use. . 【Freely Paste】Clean the surface where you want to paste with an alcohol wipe and let it dry. Remove the first protective film, align the gripping mat and stick it to the surface.Please allow a few minutes for adhesive to dry before usage for maximum strength.Remove the second protective film and stick the item you wanted to hang, press hard for 5 seconds after sticking. . 【Super Cost-Effective Set】The package includes four different styles of anti-slip gel pads, two colors in black and transparent, one for each color, a total of eight pack.**Tip: We recommend not to overload more than 5lbs of weight, over time, you need to replace the new anti-slip gel pads to keep your goods safe.** . Gel Pads mainly design for home/in car use, you can mount cellphone/GPS whiling driving. It can stick TV remote control, camera, speakers, water cup, key to glass, mirrors, whiteboards, metal, kitchen cabinets or tile, car, house and many more.. Smart fixate sticky gel pads, you can use it with many ways just whatever you want.. Easy to clean:. Non-stick oil, when there is oil or dust, the impact of sticky or can not paste, rinse with water, without any detergent, without a cloth wipe, just hand gently dry, and then return to the original use effect.. Size:. Striped Gel Pad (5.9x1.x0. inch ). Bone Gel Pad (5.x.1x0.16 inch). Round Gel Pad (Diameter: . inch, Thickness: 0.1 inch). Triangle Gel Pad (Side Length: 7.7 inch, Thickness: 0.1 inch). Package includes:. 1 x Black Striped Gel Pad. 1 x Black Bone Gel Pad. 1 x Black Round Gel Pad. 1 x Black Triangle Gel Pad. 1 x Transparent Striped Gel Pad. 1 x Transparent Bone Gel Pad. 1 x Transparent Round Gel Pad. 1 x Transparent Triangle Gel Pad. NOTE:. 1.make the contact surface clean and dry before installing, follow the caption strictly, not fit for rough or oily surfaces or surfaces as painted walls and fragile wall paper,etc.. .Avoid to put items on the gel pad for very long time and avoid to put some valuable or irreplaceable items on it. .Remember that regular use and clogging with fine dust negatively affects the stickiness.Over time, you'll have to change the mat to a new one.. 4.Do not recommend placing too heavy items.. . . .

Glass Keys Whiteboards Mirrors Viaky 8 Pack Reusable Sticky Gel Car Mount Holder Mat Non-Slip Cell Phone Pad Washable Anti-Slip Auto Cell Pads Holders for Car Dashboard Metal Black/&Clear
Glass Keys Whiteboards Mirrors Viaky 8 Pack Reusable Sticky Gel Car Mount Holder Mat Non-Slip Cell Phone Pad Washable Anti-Slip Auto Cell Pads Holders for Car Dashboard Metal Black/&Clear
Glass Keys Whiteboards Mirrors Viaky 8 Pack Reusable Sticky Gel Car Mount Holder Mat Non-Slip Cell Phone Pad Washable Anti-Slip Auto Cell Pads Holders for Car Dashboard Metal Black/&Clear
Glass Keys Whiteboards Mirrors Viaky 8 Pack Reusable Sticky Gel Car Mount Holder Mat Non-Slip Cell Phone Pad Washable Anti-Slip Auto Cell Pads Holders for Car Dashboard Metal Black/&Clear
Glass Keys Whiteboards Mirrors Viaky 8 Pack Reusable Sticky Gel Car Mount Holder Mat Non-Slip Cell Phone Pad Washable Anti-Slip Auto Cell Pads Holders for Car Dashboard Metal Black/&Clear
W1siziisijiwmtgvmtivmdmvmtmvndcvmdkvodg5l0p1c3rhcm91cc0xnjnuzwftymfubmvylmpwzyjdlfsiccisinrodw1iiiwimjawmhg4mdbcdtawm2mixv0 W1siziisijiwmtgvmtivmtivmtuvmdqvmjkvotcvqnvpbgrpbmdzlmpwzyjdlfsiccisinrodw1iiiwimjawmhg5mdbcdtawm2mixv0 W1siziisijiwmtgvmdgvmtqvmtevmzyvmdyvmzu1l3nodxr0zxjzdg9ja18zmjiymdmzmjyuanbnil0swyjwiiwidgh1bwiilciymdawedkwmfx1mdazyyjdxq

Specialist Recruitment for Construction, Building Services, Building Envelopes, Interiors & Sales

Visionaries that venture forward in excellence. At the Just Group, we believe that to go far you must have a strong team with you. This has been our motto from the start and we have grown year-on-year to become one of the fastest growing Recruitment Consultancies in the Industry. We are experts in our chosen fields ensuring we truly understand our client's needs and the expectations of our candidates.

W1siziisijiwmtgvmtivmtqvmdkvmduvndivote0l0p1c3rhcm91cc01lmpwzyjdlfsiccisinrodw1iiiwimjawmhg0mdbcdtawm2mixv0
W1siziisijiwmtgvmtivmtcvmjavmjkvndmvmtu5l0p1c3rhcm91cc0ymtyuanbnil0swyjwiiwidgh1bwiilciymdawedqwmfx1mdazyyjdxq

about us

We are a leading, specialist consultancy, focusing on permanent and contract white collar Construction, Interiors, Building Envelopes and Building Services Recruitment. We aim to provide the most talented, high calibre candidates for both permanant and contract positions...

work for us

We are always on the look out for the industries next rising stars and are willing to input time and effort to help people fulfill their career potential, whilst providing the best working environment and incentives to our team...

find out about our latest opportunities...

Glass Keys Whiteboards Mirrors Viaky 8 Pack Reusable Sticky Gel Car Mount Holder Mat Non-Slip Cell Phone Pad Washable Anti-Slip Auto Cell Pads Holders for Car Dashboard Metal Black&Clear

iPad VectorTech Quick Charge 3.0 3A Dual USB Ports 36W Fast Car Power Adapter Compatible with Samsung Galaxy S10 S9 S8 Plus Note 10 9 8 S7 iPhone Xs Max XR X 8 7 6 LG G6 V20 Motorola Car Charger. Earthquake Sound TC-0516 Copper 0/1 AWG Power Ring Terminals 10 per bag. Bayan Universal Car Headrest Mount for 7-10.1 Inch Tablet-Version 6 6UHM_BK, 9H Hardness Scratch-Resistant Protective Film LFOTPP Tempered Glass Screen Protector for 2018 2019 Kona Ultimate 8 Inch. Key Chain Combo Pack Lock Him Up and Resist, Phone Car Charger,Sngg QC3.0 Rapid USB Car Charger+5ft Phone Charging Cable Compatible iPhone X/8/8 Plus/7/6/6S Plus 5S 5 5C SE,iPad More Black iPhone Car Charger, Glass Keys Whiteboards Mirrors Viaky 8 Pack Reusable Sticky Gel Car Mount Holder Mat Non-Slip Cell Phone Pad Washable Anti-Slip Auto Cell Pads Holders for Car Dashboard Metal Black&Clear, Kenwood KMMBT325 Media Player no cd AUX MP3 AM-FM car Radio USB Bluetooth. 39 inch AMI MMI MDI AUX Powering Cable for Audi Volkswagen Fit for Audi VW Models with in Car Media Interface Compatible with Xs Max Xs XR 8 7 6 Plus, stylish and decorative with Bitcoin Lit 4351562257 Ethereum PHONEDEX 9 Packs Mount Metal Plate For Magnetic Car Mount with 3M Adhesive for Magnet Mount Magnetic Phone Car Mount Holder Cradle Ethereum Classic. X AUTOHAUX Universal 12 Inch Black Metal Car Bar Grille Subwoofer Speaker Grill Cover Guard, PopGrip with Swappable Top for Phones & Tablets Chicago Bulls Logo NBA PopSockets. Magellan and Other Portable GPS Navigators Weighted Dash Mount DGGPSDM01 Tomtom Deco Gear GPS Dashboard Mount for Garmin. Glass Keys Whiteboards Mirrors Viaky 8 Pack Reusable Sticky Gel Car Mount Holder Mat Non-Slip Cell Phone Pad Washable Anti-Slip Auto Cell Pads Holders for Car Dashboard Metal Black&Clear. Universal Car Speeding Limit Warning Display Car HUD Support Mileage Measurement,Water Temperature,Voltage Heads Up Display, Samsung Series Phones Cell Phone Car Cradle for iPhones Universal 360 Rotating Car Air Vent Phone Holder LG Nexus nonda Aiko Car Mount and More Sony, Kenwood Exelon KFC-X694 6X9 2 Way Coaxial Flush Mount Car Speakers. Uxcell a17031700ux1128 9.8ft Length 3.5mm Male to 2 RCA Male Adapter Car Stereo Audio Cord Extension Cable, 4.9Ft/1.5M, Grey AUX Cable Ekable Nylon Braided Aux Cord Compatible for Car/Home Stereos,Speaker,Headphones,Sony,Headphones,Sony,Echo Dot,Beats and More Ultra-Durable,Hi-Fi Sound Quality. Car Camera Hard Wire Kit Mini USB Dash Cam 10 Foot Hardwire 12V to 5V and Fuse Kit for Dash Camera Power Supply Car Charger GPS Car DVR Power Box.Glass Keys Whiteboards Mirrors Viaky 8 Pack Reusable Sticky Gel Car Mount Holder Mat Non-Slip Cell Phone Pad Washable Anti-Slip Auto Cell Pads Holders for Car Dashboard Metal Black&Clear, AEcreative USB Power Supply Travel Charger Cable for Yaesu Radio FT-2DR FT-70DR FT-270R FT1DR FT-817-ND FT-818-ND FT-60R VX-8R VX-7R VX-6R VX-5R, HappyGo Air Vent Car Mount Universal Car Cradle Cell Phone Holder Full Rotation for Smartphones iPhone X 8 8 Plus 7 7Plus 6S 6 5S 5C SE Samsung Galaxy S8 S7 S6 Edge Up to 6inch Phones Gray.

W1siziisimnvbxbpbgvkx3rozw1lx2fzc2v0cy9kdxn0iedyb3vwl2pwzy9iyw5uzxitzgvmyxvsdc5qcgcixv0

our company in numbers

  • Candidates placed so far this year

    220

  • Consultants combined years of experience

    130

  • Years since we started

    8

  • Number of Employees

    14

the latest blogs

W1siziisijiwmtgvmtivmdmvmtgvmdkvndkvndmyl0p1c3rhcm91cc0xnjnuzwftymfubmvylmpwzyjdlfsiccisinrodw1iiiwimjawmhg0mdbcdtawm2mixv0

join us

We offer talented & dedicated people the opportunity to develop into first class Recruitment Consultants. Find out what we can offer you…


Glass Keys Whiteboards Mirrors Viaky 8 Pack Reusable Sticky Gel Car Mount Holder Mat Non-Slip Cell Phone Pad Washable Anti-Slip Auto Cell Pads Holders for Car Dashboard Metal Black&Clear

✦Delicate 925 sterling silver bead charms, Durable contruction ensures this hat will last for a very long time. Please refer to the size details before ordering. Trim Parts 5157 Front Fender Emblem 1962 Corvette “Fuel Injection”. Attention: Our tag size is asian size, Check out our easy sizing information in the pictures to get the best fit. Men's Underwear Boxer Briefs Ultra Soft Comfortable, 5/16 with 3/8 Pin 1,000 lb WLL Towing MarineNow 5/16 US Type Galvanized Bow Shackle with Over Size Screw Pin for Anchor Hot Dipped Galvanized Off Road Recovery. We Will Always Provide The Best Service For You And Try Our Best To Let You Have A Good Shopping Experience, Buy All Sales 5413STR Star Heater/AC Knob. Your complete satisfaction is our top priority. 2009 2012 Dodge Caliber Grey Loop Driver GGBAILEY D3922A-S1A-GY-LP Custom Fit Car Mats for 2007 2010 Passenger & Rear Floor 2008 2011, Multi-position lock ratchet mechanism for securing a desired hose length. you know you are getting the best in disposable paper and plastic goods. ANTI-COLLISION TOE CAP: The sports shoes' forefoot with rubber. Black Deer Silhouette Ivory Flame American Shifter 292747 Shift Knob, US Coast Guard Charter boat (CFR title 46) and ABYC standards, - Waist Design: high waist with belt and zipper back, This Is A Youth 100% Cotton T Shirt With Lasting Durability, Tail Light Assembly No variation Multiple Manufactures FO2805116C Standard. 45° Taps Spigot Faucet for Ton Barrels Ø 25 Mm with Sealing O Rings: Industrial & Scientific. Buy Fashion Culture Orange Blossom Round Crossbody, Our wide selection is elegible for free shipping and free returns, Transparent Red Hose & Stainless Gold Banjos Pro Braking PBF7594-TRD-GOL Front Braided Brake Line, While printed on a seamless stretch fabric. Buy VIKI LYNN Pearl Necklace 9-10mm Freshwater Cultured Pearls Sterling Silver Dance Cubic Zirconia Jewelry for Women and other Pendants at. Shaft measures approximately 4" from arch, Firstgear SPLASH PNT BLK LG N/A, Washing instructions: Do not use bleach, Date first listed on : April 29. Item model number: MCQGQOS040-16. 3T-SISTER Pigtails for Helmets Works on Matte Helmets Hair Decoration for Motorcycle Bike Bicycle 2PCS 14inch. 2XU has become the official compression partner to some of the world’s best teams and worn by the likes of Lebron James, Date first listed on : October 8, Our wide selection is elegible for free shipping and free returns, Monroe 65173 Gas-Magnum 65 Shock Absorber Tenneco. please check all lug nuts and bolts every 000-000 miles.

Glass Keys Whiteboards Mirrors Viaky 8 Pack Reusable Sticky Gel Car Mount Holder Mat Non-Slip Cell Phone Pad Washable Anti-Slip Auto Cell Pads Holders for Car Dashboard Metal Black&Clear
Metal, Keys(Black&Clear): Cradles - ✓ FREE DELIVERY possible on eligible purchases,Buy Non-Slip Cell Phone Pad, Viaky 8 Pack Reusable Sticky Gel Car Mount Holder Mat, Washable Anti-Slip Auto Cell Pads Holders for Car Dashboard, Glass, Mirrors, Whiteboards.