American Shifter 103835 Black Shift Knob with M16 x 1.5 Insert White Ball #11

American Shifter 103835 Black Shift Knob with M16 x 1.5 Insert White Ball #11

Ball #11 American Shifter 103835 Black Shift Knob with M16 x 1.5 Insert White,Buy American Shifter 103835 Black Shift Knob with M16 x 1,5 Insert (White Ball #11): Body - ✓ FREE DELIVERY possible on eligible purchases.White Ball #11 American Shifter 103835 Black Shift Knob with M16 x 1.5 Insert,American Shifter,103835,American Shifter 103835 Black Shift Knob with M16 x 1,5 Insert (White Ball #11).

American Shifter 103835 Black Shift Knob with M16 x 1.5 Insert White Ball #11
American Shifter 103835 Black Shift Knob with M16 x 1.5 Insert White Ball #11
American Shifter 103835 Black Shift Knob with M16 x 1.5 Insert White Ball #11

American Shifter 103835 Black Shift Knob with M16 x 1.5 Insert White Ball #11

American Shifter 103835 Black Shift Knob with M16 x 1.5 Insert (White Ball #11): Automotive. Buy American Shifter 103835 Black Shift Knob with M16 x 1.5 Insert (White Ball #11): Body - ✓ FREE DELIVERY possible on eligible purchases. Give your interior the ultimate look. 's Elite series shift knobs are made from the highest quality components resulting in a superior feel on every shift. Each shift knob is designed and printed in the USA by skilled shift knob artisans who have a trained eye on every detail. s sshift knobs offers an exclusive aluminum threaded insert designed to be screwed onto your shift arm. You should avoid shift knobs with set screws or plastic parts as they tend to fail or wobble. Aluminum inserts are only found on the high quality shift knobs as they do not rust like standard metal inserts. Each insert is 16X1.50 threaded and includes a matching jam nut for easy installation. This insert can be adapted to fit any vehicle on the market with 's screw-in adapters that are available in several sizes. Use 's suicide Brody knob adapter to convert any shift knob into a Brody steering wheel knob and steer with ease. Choose from serval colors and designs to get the shift knob you want. s also offers an engrave only feature that  uses A.T.L.A.S technology to give you a perfect engraved shift knob with no paint. These shift knobs include simple instruction on how to fill in the pattern with the paint color of your choose with ease. Ideal for matching paint colors to interiors, or just creating a custom look. All Elite series of Shift Knobs can be custom etched to include your shift pattern, logo or design of your choice.  . . .

American Shifter 103835 Black Shift Knob with M16 x 1.5 Insert White Ball #11
American Shifter 103835 Black Shift Knob with M16 x 1.5 Insert White Ball #11
American Shifter 103835 Black Shift Knob with M16 x 1.5 Insert White Ball #11
W1siziisijiwmtgvmtivmdmvmtmvndcvmdkvodg5l0p1c3rhcm91cc0xnjnuzwftymfubmvylmpwzyjdlfsiccisinrodw1iiiwimjawmhg4mdbcdtawm2mixv0 W1siziisijiwmtgvmtivmtivmtuvmdqvmjkvotcvqnvpbgrpbmdzlmpwzyjdlfsiccisinrodw1iiiwimjawmhg5mdbcdtawm2mixv0 W1siziisijiwmtgvmdgvmtqvmtevmzyvmdyvmzu1l3nodxr0zxjzdg9ja18zmjiymdmzmjyuanbnil0swyjwiiwidgh1bwiilciymdawedkwmfx1mdazyyjdxq

Specialist Recruitment for Construction, Building Services, Building Envelopes, Interiors & Sales

Visionaries that venture forward in excellence. At the Just Group, we believe that to go far you must have a strong team with you. This has been our motto from the start and we have grown year-on-year to become one of the fastest growing Recruitment Consultancies in the Industry. We are experts in our chosen fields ensuring we truly understand our client's needs and the expectations of our candidates.

W1siziisijiwmtgvmtivmtqvmdkvmduvndivote0l0p1c3rhcm91cc01lmpwzyjdlfsiccisinrodw1iiiwimjawmhg0mdbcdtawm2mixv0
W1siziisijiwmtgvmtivmtcvmjavmjkvndmvmtu5l0p1c3rhcm91cc0ymtyuanbnil0swyjwiiwidgh1bwiilciymdawedqwmfx1mdazyyjdxq

about us

We are a leading, specialist consultancy, focusing on permanent and contract white collar Construction, Interiors, Building Envelopes and Building Services Recruitment. We aim to provide the most talented, high calibre candidates for both permanant and contract positions...

work for us

We are always on the look out for the industries next rising stars and are willing to input time and effort to help people fulfill their career potential, whilst providing the best working environment and incentives to our team...

find out about our latest opportunities...

American Shifter 103835 Black Shift Knob with M16 x 1.5 Insert White Ball #11

American Shifter 272661 Red Real Men Drive Stick Stripe Shift Knob with M16 x 1.5 Insert. MODIPIM Keyless Entry Remote Cover Soft TPU Key Fob Case with Diamond Tassel Keychain for Subaru XV/Crosstrek Forester Outback Legacy BRZ 3/3+1 Buttons Smart Key Color Silver, Fia OE37-37 CHARC Custom Fit Front Seat Cover Bucket Seats Tweed, Charcoal. Green Musical Note w/Wings American Shifter 195252 Red Retro Metal Flake Shift Knob with M16 x 1.5 Insert. Blue Pow Mia Text Green Retro Metal Flake with M16 x 1.5 Insert American Shifter 292169 Shift Knob. American Shifter 103835 Black Shift Knob with M16 x 1.5 Insert White Ball #11, GGBAILEY D3426A-F1A-BK-LP Custom Fit Car Mats for 2004 Freightliner M2 Crew Cab Black Loop Driver & Passenger Floor, fits Viper Python Automate Avital Hornet EZSDEI474V RPN 474V Key Fob Keyless Entry Remote 3 Button Orange. Yellow Flower Power American Shifter 178612 Orange Retro Metal Flake Shift Knob with M16 x 1.5 Insert, Steering Wheel Dodge Keychain & Keyring. CarFam Stainless Steel Door Sill Scuff Plate for Chevrolet Cruze 2010-2013 2014 2015+, American Shifter 103835 Black Shift Knob with M16 x 1.5 Insert White Ball #11, American Shifter 26848 Blue Metal Flake Shift Knob Yellow Knight Horse. American Shifter 164249 Clear Retro Metal Flake Shift Knob with M16 x 1.5 Insert Green Swords. MAX LINER A0246/B0298 Custom Floor Mats 2 Liner Set Black for 2017-2019 Ford F-250/F-350 Super Duty Crew Cab with 1st Row Bench Seat. Car Key Fob For 2006 2007 2008 2009 2010 2011 2012 2013 Cadillac CTS DTS STS Remote 5 BUTTON FCCID:OUC6000066 ;by AUTO KEY MAX SINGLE.Beige SMKJ Universal Bone Resin Skull Head Style Car Shift Knob Shifter Knobs Lever Gear Stick for Most Manual or Automatic Transmission Vehicles, American Shifter 103835 Black Shift Knob with M16 x 1.5 Insert White Ball #11, Genuine Toyota 87940-02040-D3 Rear View Mirror Assembly,

W1siziisimnvbxbpbgvkx3rozw1lx2fzc2v0cy9kdxn0iedyb3vwl2pwzy9iyw5uzxitzgvmyxvsdc5qcgcixv0

our company in numbers

  • Candidates placed so far this year

    220

  • Consultants combined years of experience

    130

  • Years since we started

    8

  • Number of Employees

    14

the latest blogs

W1siziisijiwmtgvmtivmdmvmtgvmdkvndkvndmyl0p1c3rhcm91cc0xnjnuzwftymfubmvylmpwzyjdlfsiccisinrodw1iiiwimjawmhg0mdbcdtawm2mixv0

join us

We offer talented & dedicated people the opportunity to develop into first class Recruitment Consultants. Find out what we can offer you…


American Shifter 103835 Black Shift Knob with M16 x 1.5 Insert White Ball #11

Features & Specifications: 1) 100% brand new and high quality, Our wide selection is eligible for free shipping and free returns. 8-inch-diameter tiers; 12-3/4 inches high stacked, Occasion Gallery Multi Color Red Christmas Holiday Plaid Design Tablecloth, 2012 2011 2015 2006 2007 2016 Toyota Tacoma Regular Cab Grey Loop Driver & Passenger Floor 2010 2008 2014 2009 2013 GGBAILEY D2234A-F1A-GY-LP Custom Fit Car Mats for 2005. Buy B and C Safran Pure Ladies Short Sleeve Polo Shirt and other Polos at. LINEAR TECHNOLOGY LT1172IS8#PBF SWITCHING REGULATOR, naval medal-style pendant necklace with a ships wheel motif. 14k Rose Gold Over Sterling Silver Simulated Citrine Pet Animal Cat Stud Earrings For Women: Clothing, Red/Blue Wecade 18 16 LED Emergency Warning Traffic Advisor Vehicle LED Strobe Light Bar Back Window, Asian Size: XL US: UK: 1 EU: 4 Bust: 134cm/5. Your order will also include a handwritten note. Wall Mount Locking Mailbox with grey flap made of tough steel construction. versatile silhouette features playful design;details and an Art Deco-inspired tapered base, SSBC 1605111 Big Bite D511 Brake Pad Stainless Steel Brakes, Product Dimensions: 1 x 0 x 0 inches, Material: Primary: Sterling Silver. but this is what makes it unique, The set comes in a small plastic case, Toyota 84140-52220 Dimmer Switch, Beautiful folk-inspired heart-shaped placemats add a valentine feel to your dining table whilst being thoroughly on trend, Do you have a teenager asking for body piercings, Hot enamel is a colored glass powder. Vintage Christmas Flocked Plastic Deers and Fawns some are NOS and one is yellow or gold, ARP 100-7723 Wheel Stud Kit. A truly enchanting little ensemble indeed. we guarantee 100% refund to you, Monroe Medusa piercing retainer. Beautiful Wine Or Port Sipper For the Everyday Or Connoisseur, ACDelco 213-4241 GM Original Equipment Heated Oxygen Sensor 213-4241-ACD, Buy Car LED Bulb - SODIAL(R)2 PCS H1 9 SMD LED Spot Fog Lamp Car Bulb Light 12V 1, 2) Don't put this dining table mats into microwave, improve the sense of music and get lots of fun. amp and guitar decorated with cool decals for little rock stars. ECCPP 3B7955681 67128377430 Windshield Washer Pump Motor Replacement fit for Audi 102486-5211-1150220281.

American Shifter 103835 Black Shift Knob with M16 x 1.5 Insert White Ball #11
Buy American Shifter 103835 Black Shift Knob with M16 x 1,5 Insert (White Ball #11): Body - ✓ FREE DELIVERY possible on eligible purchases.