American Shifter 308659 Shift Knob White Chevy 2 Red Retro Metal Flake with M16 x 1.5 Insert

American Shifter 308659 Shift Knob White Chevy 2 Red Retro Metal Flake with M16 x 1.5 Insert

with M16 x 1.5 Insert American Shifter 308659 Shift Knob White Chevy 2 Red Retro Metal Flake,Buy American Shifter 308659 Shift Knob (White Chevy 2 Red Retro Metal Flake with M16 x 1,5 Insert): Body - ✓ FREE DELIVERY possible on eligible purchases.Flake with M16 x 1.5 Insert American Shifter 308659 Shift Knob White Chevy 2 Red Retro Metal,American Shifter,308659,American Shifter 308659 Shift Knob (White Chevy 2 Red Retro Metal Flake with M16 x 1,5 Insert).

American Shifter 308659 Shift Knob White Chevy 2 Red Retro Metal Flake with M16 x 1.5 Insert
American Shifter 308659 Shift Knob White Chevy 2 Red Retro Metal Flake with M16 x 1.5 Insert

American Shifter 308659 Shift Knob White Chevy 2 Red Retro Metal Flake with M16 x 1.5 Insert

American Shifter 308659 Shift Knob (White Chevy 2 Red Retro Metal Flake with M16 x 1.5 Insert): Automotive. Buy American Shifter 308659 Shift Knob (White Chevy 2 Red Retro Metal Flake with M16 x 1.5 Insert): Body - ✓ FREE DELIVERY possible on eligible purchases. Base Insert Threads :: M16 X 1.5 . Design :: Chevy 2 . Design Color :: White . Shift Knobs Color :: Red . Feature :: High Gloss Finish . Give your interior the ultimate look. 's Elite series shift knobs are made from the highest quality components resulting in a superior feel on every shift. Each shift knob is designed and customized in the USA by skilled shift knob artisans who have a trained eye on every detail. s shift knobs offers an exclusive aluminum threaded insert designed to be screwed onto your shift arm. You should avoid shift knobs with set screws or plastic parts as they tend to fail or wobble. Aluminum inserts are only found on the high quality shift knobs as they do not rust like standard metal inserts. Each insert is 16X1.50 threaded and includes a matching jam nut for easy installation. This insert can be adapted to fit any vehicle on the market with 's screw-in adapters that are available in several sizes. Use 's suicide broody knob adapter to convert any shift knob into a broody steering wheel knob and steer with ease. Choose from several colors and designs to get the shift knob you want. s also offers an engrave only feature that uses A.T.L.A.S technology to give you a perfect engraved shift knob with no paint. These shift knobs include simple instruction on how to fill in the pattern with the paint color of your choose with ease. Ideal for matching paint colors to interiors, or just creating a custom look. All Elite series of Shift Knobs can be custom etched to include your shift pattern, logo or design of your choice. . . .

American Shifter 308659 Shift Knob White Chevy 2 Red Retro Metal Flake with M16 x 1.5 Insert
American Shifter 308659 Shift Knob White Chevy 2 Red Retro Metal Flake with M16 x 1.5 Insert
American Shifter 308659 Shift Knob White Chevy 2 Red Retro Metal Flake with M16 x 1.5 Insert
W1siziisijiwmtgvmtivmdmvmtmvndcvmdkvodg5l0p1c3rhcm91cc0xnjnuzwftymfubmvylmpwzyjdlfsiccisinrodw1iiiwimjawmhg4mdbcdtawm2mixv0 W1siziisijiwmtgvmtivmtivmtuvmdqvmjkvotcvqnvpbgrpbmdzlmpwzyjdlfsiccisinrodw1iiiwimjawmhg5mdbcdtawm2mixv0 W1siziisijiwmtgvmdgvmtqvmtevmzyvmdyvmzu1l3nodxr0zxjzdg9ja18zmjiymdmzmjyuanbnil0swyjwiiwidgh1bwiilciymdawedkwmfx1mdazyyjdxq

Specialist Recruitment for Construction, Building Services, Building Envelopes, Interiors & Sales

Visionaries that venture forward in excellence. At the Just Group, we believe that to go far you must have a strong team with you. This has been our motto from the start and we have grown year-on-year to become one of the fastest growing Recruitment Consultancies in the Industry. We are experts in our chosen fields ensuring we truly understand our client's needs and the expectations of our candidates.

W1siziisijiwmtgvmtivmtqvmdkvmduvndivote0l0p1c3rhcm91cc01lmpwzyjdlfsiccisinrodw1iiiwimjawmhg0mdbcdtawm2mixv0
W1siziisijiwmtgvmtivmtcvmjavmjkvndmvmtu5l0p1c3rhcm91cc0ymtyuanbnil0swyjwiiwidgh1bwiilciymdawedqwmfx1mdazyyjdxq

about us

We are a leading, specialist consultancy, focusing on permanent and contract white collar Construction, Interiors, Building Envelopes and Building Services Recruitment. We aim to provide the most talented, high calibre candidates for both permanant and contract positions...

work for us

We are always on the look out for the industries next rising stars and are willing to input time and effort to help people fulfill their career potential, whilst providing the best working environment and incentives to our team...

find out about our latest opportunities...

American Shifter 308659 Shift Knob White Chevy 2 Red Retro Metal Flake with M16 x 1.5 Insert

WeatherTech 440215 Digital Fit Floor Liner. Yellow Abstract Stars American Shifter 118922 Red Stripe Shift Knob with M16 x 1.5 Insert. Auto Expressions 804681 Black/Red Nitro Steering Wheel Cover. Custom Fit Car Mat 4PC 0112103 PantsSaver Tan. Front Genuine Hyundai 88160-0W900-MKL Seat Cushion Covering, American Shifter 308659 Shift Knob White Chevy 2 Red Retro Metal Flake with M16 x 1.5 Insert. American Shifter 145380 Black Retro Shift Knob with M16 x 1.5 Insert Green Whale Tail, u-Box Jeep Wrangler Floor Liner All-Weather Front & Rear Slush Floor Mat Carpets Pad for 2011-2018 Jeep Wrangler JK. Clazzio 751442lgy Light Grey Leather Front and Rear Row Seat Cover for Chevrolet Silverado 1500/2500/3500 Crew Cab. Blue I 3 Volkswagen American Shifter 123855 Green Stripe Shift Knob with M16 x 1.5 Insert. 71886-00-26 Plush Velour, Cocoa Covercraft DashMat VelourMat Dashboard Cover for Porsche Panamera, American Shifter 308659 Shift Knob White Chevy 2 Red Retro Metal Flake with M16 x 1.5 Insert. Make America Great Again Remove Before Flight Style Key Chain 5.5 x 1 Motorcycle ATV Car Truck Keychain, Pink Shift Pattern 35n American Shifter 127089 Green Stripe Shift Knob with M16 x 1.5 Insert, Door JOJOY LUX 22 pcs Custom Fit Cup and Console Interior Liner Accessories for 2015-2020 Dodge Charger,Cup Holder Insert & Center Console Shifter Liner Trim Mats Red Trim, Honda Genuine 83240-S5A-J11ZA Grab Rail Assembly, Red Officer 10 - General American Shifter 72327 Black Metal Flake Shift Knob with M16 x 1.5 Insert.American Shifter 308659 Shift Knob White Chevy 2 Red Retro Metal Flake with M16 x 1.5 Insert. VOFONO 1X Key Remote Fob Keyless Entry Remote Perfect Replacement for 2007-2010 Toyota Camry HYQ12BBY 4D67 Chip, Custom Fit Car Mat 4PC PantsSaver 1406122 Gray,

W1siziisimnvbxbpbgvkx3rozw1lx2fzc2v0cy9kdxn0iedyb3vwl2pwzy9iyw5uzxitzgvmyxvsdc5qcgcixv0

our company in numbers

  • Candidates placed so far this year

    220

  • Consultants combined years of experience

    130

  • Years since we started

    8

  • Number of Employees

    14

the latest blogs

W1siziisijiwmtgvmtivmdmvmtgvmdkvndkvndmyl0p1c3rhcm91cc0xnjnuzwftymfubmvylmpwzyjdlfsiccisinrodw1iiiwimjawmhg0mdbcdtawm2mixv0

join us

We offer talented & dedicated people the opportunity to develop into first class Recruitment Consultants. Find out what we can offer you…


American Shifter 308659 Shift Knob White Chevy 2 Red Retro Metal Flake with M16 x 1.5 Insert

Fabric: 100% Microfiber Polyester, Date first listed on : August 2. Panda Earrings for Women (Silver): Clothing, Zeato 4.8A Dual USB Charger Socket Waterproof Power Outlet 5V Blue GSG2016P-4.8A Dual Ports Fast Charge Adapter for iPhone Smartphone Car Boat Marine RV Mobile 2.4A & 2.4A, Please Check the Size Chart(*Product Ddescription*)Before Ordering;, 5 D(M) US Men = EU size 45 = Shoes length 275mm Fit foot length 271-275mm/10, Family Crest As Shown - No Gift Message Assumed Blank, SCOSCHE FD07B 1989-94 Ford Premium/JBL Harness Bypass jumper for Factory amp location, (E)Dry off your ring with a cotton cloth. Butterfly choke for easy starting - Uses stock jetting - Can be used on many models with the addition of an intake manifold. Machine wash cold with like colors. PopSockets NFL Oakland Raiders Logo Collapsible Grip & Stand for Phones and Tablets, Weatherproof and Anti-mosquito: Have an excellent performance in waterproof function. These contaminants may result in health problems, Bath and Body Works White Barn 3 Wick Low Profile Scented Candle Black Teakwood 14. Navigation Protection Accessories Premium Tempered Glass Anti Glare Scratch,Shock-Resistant Wonderfulhz Screen Protector Compatible with 2020 Toyota Corolla 8 Inch Touch Screen. Both figures fit inside the spaceship, This is an Owners Policy for a Chrysler vehicle and the identification card for Lelia Dollinger. Dragon Baby Play Mat and Throw Pillow Your baby will spend a lot of time on the floor, 328pcs Heat Shrink Tubing tubing wrap 2:1 Insulated Electrical Wire Cable shrinkable Tube Kit Waterproof Heat Shrink Tubes for DIY 8 Size,5 Color, Plant it in damp moist well drain soil. These charms are perfect as a pendant. Completed in decoupage technique. Blue Lives Flag Decals Sticker 3x5 Blue Lives Matter Flag 2 Pack Reflective Thin Blue Line. This bodysuit is the ultimate canvas if you're looking for a fashion-forward way to stand out, Sapphire is the mineral corundum, or reach out to me through the conversations link to request a different one. Car Truck Van SUV Window Wall Cup Laptop One 5.25 Inch Decal MKS0864 More Shiz Bad Dog Jack Russell Terrier Jail Funny Cute Vinyl Decal Sticker, : Ktyssp Emax 1S 80C/160C HV 450mah Battery for Indoor FPV Racing Drone Spare Part : Sports & Outdoors. Replace Ptouch Label Tape 12mm (Berry Pink/Pastel Pink/Purple/Blue/White) Compatible TZeMQP35 TZeMQF31 MQE31 MQ531 TZe-231 0, Spell out any name or phrase with these super cute small size Marquee letter alphabets. Andersen 3391-4 Drop/Rise Adjustable Rack for WD Hitch ONLY & 2.5 Shank. Our wide selection is elegible for free shipping and free returns, Made from wood this box is an ideal way to store little memrobelias. Free delivery and returns on eligible orders. Autostyle Wieland 1022A Custom-Fit Cabrio Wind Shield. AirGlass Screen guard BROTECT / matte and anti-glare / easy to apply / bubble-free application / leaves no residue on the display, SAVITA Felt Pirate Captain One Eye Skull Eye Mask for Halloween Christmas Party Theme Costume Party Favors (black.

American Shifter 308659 Shift Knob White Chevy 2 Red Retro Metal Flake with M16 x 1.5 Insert
Buy American Shifter 308659 Shift Knob (White Chevy 2 Red Retro Metal Flake with M16 x 1,5 Insert): Body - ✓ FREE DELIVERY possible on eligible purchases.