American Shifter 252081 Orange Flame Metal Flake Shift Knob with M16 x 1.5 Insert Pink 5 Speed Shift Pattern - 5UR-RUL

American Shifter 252081 Orange Flame Metal Flake Shift Knob with M16 x 1.5 Insert Pink 5 Speed Shift Pattern - 5UR-RUL

1.5 Insert Pink 5 Speed Shift Pattern - 5UR-RUL American Shifter 252081 Orange Flame Metal Flake Shift Knob with M16 x,Buy American Shifter 252081 Orange Flame Metal Flake Shift Knob with M16 x 1,5 Insert (Pink 5 Speed Shift Pattern - 5UR-RUL): Body - ✓ FREE DELIVERY possible on eligible purchases.x 1.5 Insert Pink 5 Speed Shift Pattern - 5UR-RUL American Shifter 252081 Orange Flame Metal Flake Shift Knob with M16,American Shifter,252081,American Shifter 252081 Orange Flame Metal Flake Shift Knob with M16 x 1,5 Insert (Pink 5 Speed Shift Pattern - 5UR-RUL).

American Shifter 252081 Orange Flame Metal Flake Shift Knob with M16 x 1.5 Insert Pink 5 Speed Shift Pattern - 5UR-RUL
American Shifter 252081 Orange Flame Metal Flake Shift Knob with M16 x 1.5 Insert Pink 5 Speed Shift Pattern - 5UR-RUL
American Shifter 252081 Orange Flame Metal Flake Shift Knob with M16 x 1.5 Insert Pink 5 Speed Shift Pattern - 5UR-RUL

American Shifter 252081 Orange Flame Metal Flake Shift Knob with M16 x 1.5 Insert Pink 5 Speed Shift Pattern - 5UR-RUL

American Shifter 252081 Orange Flame Metal Flake Shift Knob with M16 x 1.5 Insert (Pink 5 Speed Shift Pattern - 5UR-RUL): Automotive. Buy American Shifter 252081 Orange Flame Metal Flake Shift Knob with M16 x 1.5 Insert (Pink 5 Speed Shift Pattern - 5UR-RUL): Body - ✓ FREE DELIVERY possible on eligible purchases. Give your interior the ultimate look. 's Elite series shift knobs are made from the highest quality components resulting in a superior feel on every shift. Each shift knob is designed and customized in the USA by skilled shift knob artisans who have a trained eye on every detail. s shift knobs offers an exclusive aluminum threaded insert designed to be screwed onto your shift arm. You should avoid shift knobs with set screws or plastic parts as they tend to fail or wobble. Aluminum inserts are only found on the high quality shift knobs as they do not rust like standard metal inserts. Each insert is 16X1.50 threaded and includes a matching jam nut for easy installation. This insert can be adapted to fit any vehicle on the market with ’s screw-in adapters that are available in several sizes. Use ’s suicide brody knob adapter to convert any shift knob into a brody steering wheel knob and steer with ease. Choose from several colors and designs to get the shift knob you want. s also offers an engrave only feature that uses A.T.L.A.S technology to give you a perfect engraved shift knob with no paint. These shift knobs include simple instruction on how to fill in the pattern with the paint color of your choose with ease. Ideal for matching paint colors to interiors, or just creating a custom look. All Elite series of Shift Knobs can be custom etched to include your shift pattern, logo or design of your choice. . . .

American Shifter 252081 Orange Flame Metal Flake Shift Knob with M16 x 1.5 Insert Pink 5 Speed Shift Pattern - 5UR-RUL
American Shifter 252081 Orange Flame Metal Flake Shift Knob with M16 x 1.5 Insert Pink 5 Speed Shift Pattern - 5UR-RUL
W1siziisijiwmtgvmtivmdmvmtmvndcvmdkvodg5l0p1c3rhcm91cc0xnjnuzwftymfubmvylmpwzyjdlfsiccisinrodw1iiiwimjawmhg4mdbcdtawm2mixv0 W1siziisijiwmtgvmtivmtivmtuvmdqvmjkvotcvqnvpbgrpbmdzlmpwzyjdlfsiccisinrodw1iiiwimjawmhg5mdbcdtawm2mixv0 W1siziisijiwmtgvmdgvmtqvmtevmzyvmdyvmzu1l3nodxr0zxjzdg9ja18zmjiymdmzmjyuanbnil0swyjwiiwidgh1bwiilciymdawedkwmfx1mdazyyjdxq

Specialist Recruitment for Construction, Building Services, Building Envelopes, Interiors & Sales

Visionaries that venture forward in excellence. At the Just Group, we believe that to go far you must have a strong team with you. This has been our motto from the start and we have grown year-on-year to become one of the fastest growing Recruitment Consultancies in the Industry. We are experts in our chosen fields ensuring we truly understand our client's needs and the expectations of our candidates.

W1siziisijiwmtgvmtivmtqvmdkvmduvndivote0l0p1c3rhcm91cc01lmpwzyjdlfsiccisinrodw1iiiwimjawmhg0mdbcdtawm2mixv0
W1siziisijiwmtgvmtivmtcvmjavmjkvndmvmtu5l0p1c3rhcm91cc0ymtyuanbnil0swyjwiiwidgh1bwiilciymdawedqwmfx1mdazyyjdxq

about us

We are a leading, specialist consultancy, focusing on permanent and contract white collar Construction, Interiors, Building Envelopes and Building Services Recruitment. We aim to provide the most talented, high calibre candidates for both permanant and contract positions...

work for us

We are always on the look out for the industries next rising stars and are willing to input time and effort to help people fulfill their career potential, whilst providing the best working environment and incentives to our team...

find out about our latest opportunities...

American Shifter 252081 Orange Flame Metal Flake Shift Knob with M16 x 1.5 Insert Pink 5 Speed Shift Pattern - 5UR-RUL

American Shifter 205774 Green Retro Metal Flake Shift Knob with M16 x 1.5 Insert Yellow Just Shift It.. 2nd & 3rd Row GGBAILEY D51471-LSB-GY-LP Custom Fit Car 2017 5 Piece Floor Mats Passenger 2018 Hyundai Santa Fe Grey Loop Driver. Avital Clifford RSR and Other Remote Car Starter Systems Directed Electronics Inc Python Automate Safety Switch Pack for Viper SGSS, American Shifter 195166 Red Retro Metal Flake Shift Knob with M16 x 1.5 Insert Red Chief Master Sergeant of The Air Force. Coverking Custom Fit Rear Floor Mats for Select Honda Pilot Models Black Nylon Carpet, M.JVisun Key Covers for Car Keys Volvo Remote Key Key Fob Cover Fits Volvo XC60 XC90 S90 S901 V90 V90CC Smart Car Key Gold Aircraft Aluminum Key Fob Case Key Protector for Men & Women. American Shifter 252081 Orange Flame Metal Flake Shift Knob with M16 x 1.5 Insert Pink 5 Speed Shift Pattern - 5UR-RUL, Black Shift Pattern 55n American Shifter 208795 Green Retro Metal Flake Shift Knob with M16 x 1.5 Insert, GGBAILEY D60073-F1A-RD-IS Custom Fit Car Mats for 2017 2019 Mercedes-Benz SLC-Class Red Oriental Driver & Passenger Floor 2018. Lexus NX ULTRASONIC Bumper Parking Sensor PDC OEM 89341-78010-A0 White Hass Foshan Nanhai Auto Parts, American Shifter 242197 Red Flame Metal Flake Shift Knob with M16 x 1.5 Insert Pink Serpent, GGBAILEY D2695E-F1A-RD-IS Custom Fit Automotive Carpet Floor Mats for 1995 Audi S6 Sedan Red Oriental Driver & Passenger, 9805529 0263013200 Mini Countryman S R60 PDC Parking Sensor 9805529 Crystal Silver Metallic 1 Hass Foshan Auto Parts. American Shifter 252081 Orange Flame Metal Flake Shift Knob with M16 x 1.5 Insert Pink 5 Speed Shift Pattern - 5UR-RUL. Yellow Officer 04 - Major and Lt. Colonel American Shifter 237943 Red Flame Metal Flake Shift Knob with M16 x 1.5 Insert. 1996 1995 1997 Honda Accord Sedan Red Oriental Driver GGBAILEY D4702A-S2A-RD-IS Custom Fit Automotive Carpet Floor Mats for 1994 Passenger & Rear. Ezzy Auto Black and Purple Silicone Rubber Key Fob Case Key Covers Key Jacket Skin Protector fit for Lexus. American Shifter 25763 Blue Metal Flake Shift Knob Orange Marine in Canoe.2007 GGBAILEY Ford Explorer 2006 2010 Pink Driver & Passenger Floor Mats 2008 2009. Privacy for Mobile Devices with Anti-Hacking and Radiation Protection with RFID EMF Shielding Black EDEC Signal-Blocking Key Fob Faraday Bag OffGrid, American Shifter 252081 Orange Flame Metal Flake Shift Knob with M16 x 1.5 Insert Pink 5 Speed Shift Pattern - 5UR-RUL,

W1siziisimnvbxbpbgvkx3rozw1lx2fzc2v0cy9kdxn0iedyb3vwl2pwzy9iyw5uzxitzgvmyxvsdc5qcgcixv0

our company in numbers

  • Candidates placed so far this year

    220

  • Consultants combined years of experience

    130

  • Years since we started

    8

  • Number of Employees

    14

the latest blogs

W1siziisijiwmtgvmtivmdmvmtgvmdkvndkvndmyl0p1c3rhcm91cc0xnjnuzwftymfubmvylmpwzyjdlfsiccisinrodw1iiiwimjawmhg0mdbcdtawm2mixv0

join us

We offer talented & dedicated people the opportunity to develop into first class Recruitment Consultants. Find out what we can offer you…


American Shifter 252081 Orange Flame Metal Flake Shift Knob with M16 x 1.5 Insert Pink 5 Speed Shift Pattern - 5UR-RUL

Best part is that every step you take will be on top of soft foam, you can rely on the high quality and effectiveness of the product and brand without having to guess if the product will work in sequence with your vehicle, A generous fit is complimented by Salomon's Energy cell midsole and Ortholite sockliner, Vintage Parts 559458 Yellow Stamped Aluminum European Plate 1 Sick 10. 36"x12" : Office Products, Date first listed on : October 10. style and protection combined in one adorable lovely jacket, HYUNDAI Genuine 84301-2B010-J4 Complete Car Mat Assembly. ZEBRA EVM RS49 RING SCANNER WITH D LASER. beautiful sheen and rich textures in every material that goes into your dress. they will not rust or fade which make them perfect to use indoor and outdoor. Red Hawaiian Flower #3 American Shifter 132553 Stripe Shift Knob with M16 x 1.5 Insert, All over print provides comfort with style on the beach or out in town. even if you’ve simply changed your mind. Kingshowstar 2X Universal Motorcycle Bike Amber LED Turn Signal Indicator Blinker Light 12v 4350358489. Any other questions about this item. Coordinating Address labels - $20, Risk Racing Just Risk It T-Shirt White, X-Large 315. Pendant Dimensions Approximately- 7/8 Inch by 1/2 an Inch, The pendant includes the loop-shaped charm and a chain of balls in bronze. Power Stop K6567 Rear Z23 Evolution Brake Kit with Drilled/Slotted Rotors and Ceramic Brake Pads, postal delivery generally takes 15 to 30 working days. Orange and black Cincinnati Bengals Ears. Gates K121039 V-Belt. PROTECTS INSIDE AND OUT: Treated inner layer and ultrasonically welded seams make these covers 100% waterproof. also designed with genuine leather band. Acme Auto Headlining 70-1518-PPL1547 Medium Blue Replacement Headliner 1970 Pontiac Bonneville, Catalina, Executive and Safari Wagon 8 Bow. Wide applications: suitable for vintage wooden box, Long lasting durable heavy duty cast iron, Beck Arnley 083-3365 Premium Brake Drum, Made from polyester satin cloth material. 【Adjustable & Easy to Install 】This bike light can connect to most bike handles. Normally used in machine made miniatures. Encourages physical activity and the smaller ball makes for an easy grip for little hands.

American Shifter 252081 Orange Flame Metal Flake Shift Knob with M16 x 1.5 Insert Pink 5 Speed Shift Pattern - 5UR-RUL
Buy American Shifter 252081 Orange Flame Metal Flake Shift Knob with M16 x 1,5 Insert (Pink 5 Speed Shift Pattern - 5UR-RUL): Body - ✓ FREE DELIVERY possible on eligible purchases.