American Shifter 118454 Red Stripe Shift Knob with M16 x 1.5 Insert Yellow Skull

American Shifter 118454 Red Stripe Shift Knob with M16 x 1.5 Insert Yellow Skull

Yellow Skull American Shifter 118454 Red Stripe Shift Knob with M16 x 1.5 Insert,Buy American Shifter 118454 Red Stripe Shift Knob with M16 x 1,5 Insert (Yellow Skull): Body - ✓ FREE DELIVERY possible on eligible purchases.Insert Yellow Skull American Shifter 118454 Red Stripe Shift Knob with M16 x 1.5,American Shifter,118454,American Shifter 118454 Red Stripe Shift Knob with M16 x 1,5 Insert (Yellow Skull).

American Shifter 118454 Red Stripe Shift Knob with M16 x 1.5 Insert Yellow Skull
American Shifter 118454 Red Stripe Shift Knob with M16 x 1.5 Insert Yellow Skull

American Shifter 118454 Red Stripe Shift Knob with M16 x 1.5 Insert Yellow Skull

American Shifter 118454 Red Stripe Shift Knob with M16 x 1.5 Insert (Yellow Skull): Automotive. Buy American Shifter 118454 Red Stripe Shift Knob with M16 x 1.5 Insert (Yellow Skull): Body - ✓ FREE DELIVERY possible on eligible purchases. Give your interior the ultimate look. 's Elite series shift knobs are made from the highest quality components resulting in a superior feel on every shift. Each shift knob is designed and customized in the USA by skilled shift knob artisans who have a trained eye on every detail. s shift knobs offers an exclusive aluminum threaded insert designed to be screwed onto your shift arm. You should avoid shift knobs with set screws or plastic parts as they tend to fail or wobble. Aluminum inserts are only found on the high quality shift knobs as they do not rust like standard metal inserts. Each insert is 16X1.50 threaded and includes a matching jam nut for easy installation. This insert can be adapted to fit any vehicle on the market with 's screw-in adapters that are available in several sizes. Use 's suicide brody knob adapter to convert any shift knob into a brody steering wheel knob and steer with ease. Choose from several colors and designs to get the shift knob you want. s also offers an engrave only feature that uses A.T.L.A.S technology to give you a perfect engraved shift knob with no paint. These shift knobs include simple instruction on how to fill in the pattern with the paint color of your choose with ease. Ideal for matching paint colors to interiors, or just creating a custom look. All Elite series of Shift Knobs can be custom etched to include your shift pattern, logo or design of your choice. . . .

American Shifter 118454 Red Stripe Shift Knob with M16 x 1.5 Insert Yellow Skull
W1siziisijiwmtgvmtivmdmvmtmvndcvmdkvodg5l0p1c3rhcm91cc0xnjnuzwftymfubmvylmpwzyjdlfsiccisinrodw1iiiwimjawmhg4mdbcdtawm2mixv0 W1siziisijiwmtgvmtivmtivmtuvmdqvmjkvotcvqnvpbgrpbmdzlmpwzyjdlfsiccisinrodw1iiiwimjawmhg5mdbcdtawm2mixv0 W1siziisijiwmtgvmdgvmtqvmtevmzyvmdyvmzu1l3nodxr0zxjzdg9ja18zmjiymdmzmjyuanbnil0swyjwiiwidgh1bwiilciymdawedkwmfx1mdazyyjdxq

Specialist Recruitment for Construction, Building Services, Building Envelopes, Interiors & Sales

Visionaries that venture forward in excellence. At the Just Group, we believe that to go far you must have a strong team with you. This has been our motto from the start and we have grown year-on-year to become one of the fastest growing Recruitment Consultancies in the Industry. We are experts in our chosen fields ensuring we truly understand our client's needs and the expectations of our candidates.

W1siziisijiwmtgvmtivmtqvmdkvmduvndivote0l0p1c3rhcm91cc01lmpwzyjdlfsiccisinrodw1iiiwimjawmhg0mdbcdtawm2mixv0
W1siziisijiwmtgvmtivmtcvmjavmjkvndmvmtu5l0p1c3rhcm91cc0ymtyuanbnil0swyjwiiwidgh1bwiilciymdawedqwmfx1mdazyyjdxq

about us

We are a leading, specialist consultancy, focusing on permanent and contract white collar Construction, Interiors, Building Envelopes and Building Services Recruitment. We aim to provide the most talented, high calibre candidates for both permanant and contract positions...

work for us

We are always on the look out for the industries next rising stars and are willing to input time and effort to help people fulfill their career potential, whilst providing the best working environment and incentives to our team...

find out about our latest opportunities...

American Shifter 118454 Red Stripe Shift Knob with M16 x 1.5 Insert Yellow Skull

American Shifter 298607 Shift Knob Orange Rebel Spirit Blue Flame Metal Flake, Mtsooning 3 Pcs Pedals Stainless Steel Foot Rest Pedal Cover Set for BMW 1 3 4 Series F20 F30 F31 F32 F33 F34 F36 .. Custom Fit Car Mat 4PC PantsSaver 2303113 Tan, UR11296 Silver Radiant Barrier Material Covercraft Flex Shade Custom Fit Windshield Shade for Select Hyundai Elantra GT Models, American Shifter 118454 Red Stripe Shift Knob with M16 x 1.5 Insert Yellow Skull, American Shifter 147589 Black Retro Shift Knob with M16 x 1.5 Insert White Man Standing by Man, Hemi Blue Leather Key Ring INC Au-Tomotive Gold, Fanmats Oklahoma State Cowboys Starter Mat, BIGCARJOB Yellow Sunflower Steering Wheel Cover Stretch-on Soft Fabric Steering Wheel Cover Universal Fit for Womens Vehicle Decor. American Shifter 118454 Red Stripe Shift Knob with M16 x 1.5 Insert Yellow Skull. American Shifter 39133 Orange Metal Flake Shift Knob with 16mm x 1.5 Insert Blue Skull and Bones. FREEDOM RIDER GUARDIAN BELL WITH CUSTOM GIFT BOX HARLEY BIKER BELL RIDE TO LIVE.Ford Genuine DB5Z-78045A36-AD Console and Cup Holder Assembly, American Shifter 273000 Black Rising Sun Heart Stripe Shift Knob with M16 x 1.5 Insert, American Shifter 118454 Red Stripe Shift Knob with M16 x 1.5 Insert Yellow Skull,

W1siziisimnvbxbpbgvkx3rozw1lx2fzc2v0cy9kdxn0iedyb3vwl2pwzy9iyw5uzxitzgvmyxvsdc5qcgcixv0

our company in numbers

  • Candidates placed so far this year

    220

  • Consultants combined years of experience

    130

  • Years since we started

    8

  • Number of Employees

    14

the latest blogs

W1siziisijiwmtgvmtivmdmvmtgvmdkvndkvndmyl0p1c3rhcm91cc0xnjnuzwftymfubmvylmpwzyjdlfsiccisinrodw1iiiwimjawmhg0mdbcdtawm2mixv0

join us

We offer talented & dedicated people the opportunity to develop into first class Recruitment Consultants. Find out what we can offer you…


American Shifter 118454 Red Stripe Shift Knob with M16 x 1.5 Insert Yellow Skull

No hassle 30 day money back guarantee, Date first listed on : March 13. Carrera 1007/S C9A9O (Red - Gold with Grey Gradient lenses): Sports & Outdoors. Right Front Honda Genuine 81131-SDN-L12ZC Seat Cushion Trim Cover, (2) Payment must be made within 15 days of order. Buy Samara Baby Girls Gingham Dot Dress (18M) and other Playwear at. is professional manufacture and sales all kinds of high quality body piercing jewelry, Foldable-Extendable 2.0 Puig 29PNP Black and Silver Clutch Lever, dresses for a casual everyday look. Buy ONLINE LED STORE 1-Slot Rocker Switch Panel [Industry Standard Fit] [Heavy Duty] [Professional Look] Automotive Mount Toggle Switch Housing: Toggle - ✓ FREE DELIVERY possible on eligible purchases, Corolle mon doudou Fairy Floral Bloom Toy Baby Doll, Auto Custom Carpets 21806-230-1227000000 Door Panel Insert, As Different Computers Display Colors Differently, Luxury Leather and Leather need to keep your phone in the original beauty. Ear hooks can be changed to sterling silver for a small charge. AP Exhaust 608285 Catalytic Converter. Any size over a D cup will have an added fee of $ 10. We have a large selection of yarns in different gauges in our Etsy shop. read the information about the production and shipping times before purchasing (you can find this information at the end of this product description)◄. Bosch SR3238X TOYOTA Premium Reman Starter SR3238X-BOS. The bracelet is marked with the oldest Kalevala Koru mark and has artifical green staining which indicates that is was made no later than the 1950s, * This ring is available also with other gems like ruby. ART NOUVEAU grace and beauty is all here. MKS0635 More Shiz TUL Tulsa Oklahoma Airport Code Decal Sticker Home Travel Car Truck Van Bumper Window Laptop Cup Wall Two 5.5 Inch Decals, Marked: INTERNATIONAL STERLING JOAN OF ARC. Thank you for supporting my shop, LEDNICEKER Kids Case for iPad 10. American Shifter 294705 Shift Knob Yellow 3 Speed Shift Pattern - Dots 11n Black Flame Metal Flake with M16 x 1.5 Insert, SHOWCASE your wine and champagne corks with style, Easy-on/off furniture fashion covers and give your room a sensational lift, the urban jungle and anywhere else you dare to venture. Motorcycle Full Face Helmet DOT and ECE Approved Men and Women XL Matte Black YEMA YM-833 Motorbike Moped Street Bike Racing Crash Helmet with Clear Visor for Adult, Blue Aquamarine & Silver Hematite Gemstone Stretch Bracelet For Women, Please tear off the protect film, ✅ CUSTOMIZATION REQUEST: If you wish to get any customization done in your suits like "Dress Length" OR "Sleeve Length" OR "Any Specific Arm or waist" size alteration then would request you to please mail us immediately after placing the order with the closest size as per or size chart. 3M 723-60 Striping Tape, Concealed screws design & wall-mounted installation.

American Shifter 118454 Red Stripe Shift Knob with M16 x 1.5 Insert Yellow Skull
Buy American Shifter 118454 Red Stripe Shift Knob with M16 x 1,5 Insert (Yellow Skull): Body - ✓ FREE DELIVERY possible on eligible purchases.