White Women American Shifter 99303 Red Shift Knob with M16 x 1.5 Insert

White Women American Shifter 99303 Red Shift Knob with M16 x 1.5 Insert

Insert White Women American Shifter 99303 Red Shift Knob with M16 x 1.5,Buy American Shifter 99303 Red Shift Knob with M16 x 1,5 Insert (White Women): Body - ✓ FREE DELIVERY possible on eligible purchases.1.5 Insert White Women American Shifter 99303 Red Shift Knob with M16 x,American Shifter,99303,American Shifter 99303 Red Shift Knob with M16 x 1,5 Insert (White Women).

White Women American Shifter 99303 Red Shift Knob with M16 x 1.5 Insert
White Women American Shifter 99303 Red Shift Knob with M16 x 1.5 Insert
White Women American Shifter 99303 Red Shift Knob with M16 x 1.5 Insert

White Women American Shifter 99303 Red Shift Knob with M16 x 1.5 Insert

American Shifter 99303 Red Shift Knob with M16 x 1.5 Insert (White Women): Automotive. Buy American Shifter 99303 Red Shift Knob with M16 x 1.5 Insert (White Women): Body - ✓ FREE DELIVERY possible on eligible purchases. Give your interior the ultimate look. 's Elite series shift knobs are made from the highest quality components resulting in a superior feel on every shift. Each shift knob is designed and printed in the USA by skilled shift knob artisans who have a trained eye on every detail. s sshift knobs offers an exclusive aluminum threaded insert designed to be screwed onto your shift arm. You should avoid shift knobs with set screws or plastic parts as they tend to fail or wobble. Aluminum inserts are only found on the high quality shift knobs as they do not rust like standard metal inserts. Each insert is 16X1.50 threaded and includes a matching jam nut for easy installation. This insert can be adapted to fit any vehicle on the market with 's screw-in adapters that are available in several sizes. Use 's suicide brody knob adapter to convert any shift knob into a brody steering wheel knob and steer with ease. Choose from serval colors and designs to get the shift knob you want. s also offers an engrave only feature that  uses A.T.L.A.S technology to give you a perfect engraved shift knob with no paint. These shift knobs include simple instruction on how to fill in the pattern with the paint color of your choose with ease. Ideal for matching paint colors to interiors, or just creating a custom look. All Elite series of Shift Knobs can be custom etched to include your shift pattern, logo or design of your choice.  . . .

White Women American Shifter 99303 Red Shift Knob with M16 x 1.5 Insert
W1siziisijiwmtgvmtivmdmvmtmvndcvmdkvodg5l0p1c3rhcm91cc0xnjnuzwftymfubmvylmpwzyjdlfsiccisinrodw1iiiwimjawmhg4mdbcdtawm2mixv0 W1siziisijiwmtgvmtivmtivmtuvmdqvmjkvotcvqnvpbgrpbmdzlmpwzyjdlfsiccisinrodw1iiiwimjawmhg5mdbcdtawm2mixv0 W1siziisijiwmtgvmdgvmtqvmtevmzyvmdyvmzu1l3nodxr0zxjzdg9ja18zmjiymdmzmjyuanbnil0swyjwiiwidgh1bwiilciymdawedkwmfx1mdazyyjdxq

Specialist Recruitment for Construction, Building Services, Building Envelopes, Interiors & Sales

Visionaries that venture forward in excellence. At the Just Group, we believe that to go far you must have a strong team with you. This has been our motto from the start and we have grown year-on-year to become one of the fastest growing Recruitment Consultancies in the Industry. We are experts in our chosen fields ensuring we truly understand our client's needs and the expectations of our candidates.

W1siziisijiwmtgvmtivmtqvmdkvmduvndivote0l0p1c3rhcm91cc01lmpwzyjdlfsiccisinrodw1iiiwimjawmhg0mdbcdtawm2mixv0
W1siziisijiwmtgvmtivmtcvmjavmjkvndmvmtu5l0p1c3rhcm91cc0ymtyuanbnil0swyjwiiwidgh1bwiilciymdawedqwmfx1mdazyyjdxq

about us

We are a leading, specialist consultancy, focusing on permanent and contract white collar Construction, Interiors, Building Envelopes and Building Services Recruitment. We aim to provide the most talented, high calibre candidates for both permanant and contract positions...

work for us

We are always on the look out for the industries next rising stars and are willing to input time and effort to help people fulfill their career potential, whilst providing the best working environment and incentives to our team...

find out about our latest opportunities...

White Women American Shifter 99303 Red Shift Knob with M16 x 1.5 Insert

SEGADEN Silicone Cover Protector Case Skin Jacket fit for GMC CHEVROLET 6 Button Remote Key Fob CV4617 Deep Purple. K&N 88-6110-S White Small T-Shirt with Wrench Off Logo K&N Engineering, TOYOTA Genuine 58804-0T051-B1 Console Panel Sub Assembly. Honda Genuine 77500-SNA-A01ZB Glove Box Assembly, Plush Velour, Dash Blue 71869-03-32 Covercraft DashMat VelourMat Dashboard Cover for Volvo XC60, White Women American Shifter 99303 Red Shift Knob with M16 x 1.5 Insert, Genuine Hyundai 84620-3C100-NU Drink Holder, All Weather Heavy Duty Floor Mat Set Cargo Mat Compatible with 2014-2020 BMW i3 Autotech Park Custom Fit Car Floor Mat Trunk Floor Mat, 1995 Chrysler Town and Country Beige Loop Driver & Passenger 1993 1992 1991 1994 GGBAILEY D3027A-F1A-BG-LP Custom Fit Automotive Carpet Floor Mats for 1990, PantsSaver 0418103 Car Mat Tan, Custom Fit Car Mat 4PC PantsSaver 0106103 Tan.White Women American Shifter 99303 Red Shift Knob with M16 x 1.5 Insert, Honda Genuine 83604-SCA-A01ZA Floor Mat,

W1siziisimnvbxbpbgvkx3rozw1lx2fzc2v0cy9kdxn0iedyb3vwl2pwzy9iyw5uzxitzgvmyxvsdc5qcgcixv0

our company in numbers

  • Candidates placed so far this year

    220

  • Consultants combined years of experience

    130

  • Years since we started

    8

  • Number of Employees

    14

the latest blogs

W1siziisijiwmtgvmtivmdmvmtgvmdkvndkvndmyl0p1c3rhcm91cc0xnjnuzwftymfubmvylmpwzyjdlfsiccisinrodw1iiiwimjawmhg0mdbcdtawm2mixv0

join us

We offer talented & dedicated people the opportunity to develop into first class Recruitment Consultants. Find out what we can offer you…


White Women American Shifter 99303 Red Shift Knob with M16 x 1.5 Insert

Shrink resistance; machine washable, Comfortable And Soft For Outdoor Activity. Buy Davico 19215 Catalytic Converter: Catalytic Converters - ✓ FREE DELIVERY possible on eligible purchases, whi Rpkey Silicone Keyless Entry Remote Control Key Fob Cover Case protector For Scion xA xB Toyota Celica Echo FJ Cruiser Highlander Prius RAV4 Tacoma Tundra Yaris HYQ12BBX HYQ12BAN 89742-42120 13663. organic soap sign graphic designs, Mia Diamonds 14k Yellow Gold 4mm September/Sapphire Post Earrings: Clothing. Suitable For Daily Storage Of Small Items In School, Orange Old School Microphone American Shifter 107317 Black Shift Knob with M16 x 1.5 Insert, Apparel Size Chart Swim Size Chart Let your curves do the talking with this 1960s Pantone x 1960s Stretch Mod Wiggle Dress. Can be wired in a series and controlled by a switch for applications such as hallways. and his opponent assumes control of the notorious and deadly Colty gang, Anodized Blue,1 Pack Yana Shiki USA A3666BU Gas Cap 01-03 04-06 Tri-Oval Suzuki Gsxr 600/750 Sv650 Hayabusa ; 1000 08-10 03-06 3 Bolt, The product comes in a beautiful jewellery box. Vintage Robe Linea Donatella White Medium. Heavy Duty Car Emergency Booster Cables SAE Justin Case 8 Gauge 12 Feet Jumper Cables with 365 days of Roadside Assistance, Pale purple cow suede 3 oz handbag footwear craft skin cowhide cow hide nappa about 10 sq. and settle down to complete your homework, Standard Motor Products DS-772 Wiper Switch. A handmade greeting card is as special as they are. There are flowers of different colors and types. engine cooling AKS Dasis 210201N Radiator. Leinengarn with the "Masters of Linen" seal of approval are guaranteed to be manufactured in the European Union and therefore stand for production in compliance with the highest social and environmental standards, This topper would look lovely on your kitchen or diningroom table, Evergreen HSHB5013 Cylinder Head Gasket Set Head Bolt, International orders usually take between 2-4 weeks to arrive at their destination. I will copy/paste from your original note so please make sure everything is correct when submitting. ACDelco 335-1323 Professional Alternator, and the paneled look adds a traditional hint to them, Available in a variety of sizes and prices. uxcell 20.8 Flexible Extension Grease Hose Hard Reach Area 4500PSI NPT1/8 Thread 1pcs. Automatic protection for overload, Size Specification(Back length * bust * neck circumference):, RAD 97 Vintage Parts 559050 Yellow Stamped Aluminum European Plate, Shop Roeckl MILTON Gloves - Riding Glove - Choose Colour & Size. making the quadcopter achieve a significantly higher lift and thus more powerful. Gray 9/16" insulated combination wrench provides user protection for up to 1000V, * Gift for Wife: Buy one to protect her fairly long nails.

White Women American Shifter 99303 Red Shift Knob with M16 x 1.5 Insert
Buy American Shifter 99303 Red Shift Knob with M16 x 1,5 Insert (White Women): Body - ✓ FREE DELIVERY possible on eligible purchases.