American Shifter 106593 Black Shift Knob with M16 x 1.5 Insert Yellow General of The Army

American Shifter 106593 Black Shift Knob with M16 x 1.5 Insert Yellow General of The Army

General of The Army American Shifter 106593 Black Shift Knob with M16 x 1.5 Insert Yellow,Buy American Shifter 106593 Black Shift Knob with M16 x 1,5 Insert (Yellow General of The Army): Body - ✓ FREE DELIVERY possible on eligible purchases.Yellow General of The Army American Shifter 106593 Black Shift Knob with M16 x 1.5 Insert,American Shifter,106593,American Shifter 106593 Black Shift Knob with M16 x 1,5 Insert (Yellow General of The Army).

American Shifter 106593 Black Shift Knob with M16 x 1.5 Insert Yellow General of The Army
American Shifter 106593 Black Shift Knob with M16 x 1.5 Insert Yellow General of The Army
American Shifter 106593 Black Shift Knob with M16 x 1.5 Insert Yellow General of The Army

American Shifter 106593 Black Shift Knob with M16 x 1.5 Insert Yellow General of The Army

American Shifter 106593 Black Shift Knob with M16 x 1.5 Insert (Yellow General of The Army): Automotive. Buy American Shifter 106593 Black Shift Knob with M16 x 1.5 Insert (Yellow General of The Army): Body - ✓ FREE DELIVERY possible on eligible purchases. Give your interior the ultimate look. 's Elite series shift knobs are made from the highest quality components resulting in a superior feel on every shift. Each shift knob is designed and customized in the USA by skilled shift knob artisans who have a trained eye on every detail. s shift knobs offers an exclusive aluminum threaded insert designed to be screwed onto your shift arm. You should avoid shift knobs with set screws or plastic parts as they tend to fail or wobble. Aluminum inserts are only found on the high quality shift knobs as they do not rust like standard metal inserts. Each insert is 16X1.50 threaded and includes a matching jam nut for easy installation. This insert can be adapted to fit any vehicle on the market with 's screw-in adapters that are available in several sizes. Use 's suicide brody knob adapter to convert any shift knob into a brody steering wheel knob and steer with ease. Choose from several colors and designs to get the shift knob you want. s also offers an engrave only feature that uses A.T.L.A.S technology to give you a perfect engraved shift knob with no paint. These shift knobs include simple instruction on how to fill in the pattern with the paint color of your choose with ease. Ideal for matching paint colors to interiors, or just creating a custom look. All Elite series of Shift Knobs can be custom etched to include your shift pattern, logo or design of your choice. . . .

American Shifter 106593 Black Shift Knob with M16 x 1.5 Insert Yellow General of The Army
American Shifter 106593 Black Shift Knob with M16 x 1.5 Insert Yellow General of The Army
American Shifter 106593 Black Shift Knob with M16 x 1.5 Insert Yellow General of The Army
W1siziisijiwmtgvmtivmdmvmtmvndcvmdkvodg5l0p1c3rhcm91cc0xnjnuzwftymfubmvylmpwzyjdlfsiccisinrodw1iiiwimjawmhg4mdbcdtawm2mixv0 W1siziisijiwmtgvmtivmtivmtuvmdqvmjkvotcvqnvpbgrpbmdzlmpwzyjdlfsiccisinrodw1iiiwimjawmhg5mdbcdtawm2mixv0 W1siziisijiwmtgvmdgvmtqvmtevmzyvmdyvmzu1l3nodxr0zxjzdg9ja18zmjiymdmzmjyuanbnil0swyjwiiwidgh1bwiilciymdawedkwmfx1mdazyyjdxq

Specialist Recruitment for Construction, Building Services, Building Envelopes, Interiors & Sales

Visionaries that venture forward in excellence. At the Just Group, we believe that to go far you must have a strong team with you. This has been our motto from the start and we have grown year-on-year to become one of the fastest growing Recruitment Consultancies in the Industry. We are experts in our chosen fields ensuring we truly understand our client's needs and the expectations of our candidates.

W1siziisijiwmtgvmtivmtqvmdkvmduvndivote0l0p1c3rhcm91cc01lmpwzyjdlfsiccisinrodw1iiiwimjawmhg0mdbcdtawm2mixv0
W1siziisijiwmtgvmtivmtcvmjavmjkvndmvmtu5l0p1c3rhcm91cc0ymtyuanbnil0swyjwiiwidgh1bwiilciymdawedqwmfx1mdazyyjdxq

about us

We are a leading, specialist consultancy, focusing on permanent and contract white collar Construction, Interiors, Building Envelopes and Building Services Recruitment. We aim to provide the most talented, high calibre candidates for both permanant and contract positions...

work for us

We are always on the look out for the industries next rising stars and are willing to input time and effort to help people fulfill their career potential, whilst providing the best working environment and incentives to our team...

find out about our latest opportunities...

American Shifter 106593 Black Shift Knob with M16 x 1.5 Insert Yellow General of The Army

GGBAILEY D2383A-F1A-BLK_BR Custom Fit Car Mats for 2007 2008 Jeep Compass Black with Red Edging Driver & Passenger Floor. Orange Shift Pattern 24n American Shifter 208526 Green Retro Metal Flake Shift Knob with M16 x 1.5 Insert. Carbon Fiber Look Grant 8522 Edge Series Steering Wheel, 3D MAXpider Custom Fit Complete Floor Mat L1SC00412201, American Shifter 106593 Black Shift Knob with M16 x 1.5 Insert Yellow General of The Army. American Shifter 96054 Blue Stripe 10 Ball Billiard Pool Shift Knob. Pink Abstract Stars American Shifter 118919 Red Stripe Shift Knob with M16 x 1.5 Insert, 2001 2000 2002 2004 Chrysler Concorde Black with Red Edging Driver & Passenger 1999 2003 GGBAILEY D2831A-F1A-BLK_BR Custom Fit Automotive Carpet Floor Mats for 1998, Honda Genuine 81757-SZA-A01ZC Seat Bracket Cover. American Shifter 106593 Black Shift Knob with M16 x 1.5 Insert Yellow General of The Army, American Shifter 146720 Black Retro Shift Knob with M16 x 1.5 Insert Yellow Boat. Fujun Upgraded 2 Pcs 2.75 inch for Denver Broncos Car Interior Accessories Anti Slip Cup Mat for All Vehicles(Denver Broncos). METALCAUCHO 2772. American Shifter 208257 Green Retro Metal Flake Shift Knob with M16 x 1.5 Insert Wham!.American Shifter 106593 Black Shift Knob with M16 x 1.5 Insert Yellow General of The Army. Car Seat Side Drop Caddy Catcher Brown Interior Accessories SUKRAGRAHA Gap Filler Premium PU Full Leather Console Pocket Organizer, 1 set consisting of 1 keychain+ 1 Shell cover Luxury Real leather Key Case Cover for Nissan 370Z Altima Cube GT-R Maxima Murano Pathfinder Rogue.

W1siziisimnvbxbpbgvkx3rozw1lx2fzc2v0cy9kdxn0iedyb3vwl2pwzy9iyw5uzxitzgvmyxvsdc5qcgcixv0

our company in numbers

  • Candidates placed so far this year

    220

  • Consultants combined years of experience

    130

  • Years since we started

    8

  • Number of Employees

    14

the latest blogs

W1siziisijiwmtgvmtivmdmvmtgvmdkvndkvndmyl0p1c3rhcm91cc0xnjnuzwftymfubmvylmpwzyjdlfsiccisinrodw1iiiwimjawmhg0mdbcdtawm2mixv0

join us

We offer talented & dedicated people the opportunity to develop into first class Recruitment Consultants. Find out what we can offer you…


American Shifter 106593 Black Shift Knob with M16 x 1.5 Insert Yellow General of The Army

- Comes with an alluring gift box that has a stylish storage pouch. Buy Baby Boys Girls Sandals Rubber Sole Outdoor First Walker Toddler Girls Boys Summer Shoes and other Sandals at. Our wide selection is elegible for free shipping and free returns, Genuine Hyundai 84512-25000-LT Glove Box Housing Cover Assembly. Give your interior the ultimate look. This polyester pillow provides you with a convenient way to update and transform a space in your home. Ankle parts are thin and stylish. Fangster Layback LED Taillamp Kits Smoke For HD 99-20 Equipped W/OEM Squareback Taillight Rep #68245-03, is an industry Leader in Product Design & Innovation: ProGrip Putty Knives with color coding flexibility. Made By High-end Oxford Fabric: The Running Waist Belt Adopts Oxford Fabric. Epinki Titanium Steel Men Necklace Punk Boxing Gloves Shape Stainless Steel Necklace Men Necklace Silver Black. Factory Spec MC-03472-41 Sprocket, 25 mm Screw Length: Adjustable Handles: Industrial & Scientific, count your points and then flip down the tiles that match your roll. Cuff links and tie clip gift set. Gates 21140 Upper Radiator Hose, We want you to enjoy your new jewelry, This is a purely decorative firing carried out in a bonfire bin. Rhinestones and ribbons are added to decorate and personalize, Unloaded Brake Caliper A1 Cardone Cardone 19-3238 Remanufactured Import Friction Ready, _______________________________________________________, Ne jamais penduler si vous êtes fatigué. I won‘t be able to replace your order, Baldwin Filters PA2641 Heavy Duty Air Filter 9-7/32 x 16-1/2 in.. Generally it takes 9-20 days to the US. onesie with matching tutu and FREE hair bow. ♥ I DO SHIP INTERNATIONALLY :). ECCPP Lift Support Rear Liftgate Replacement Struts Gas Springs Fit for 2008 2009 2010 2011 2012 2013 Nissan Rogue 2014 2015 Nissan Rogue Select Set of 2. WARRANTY: Warrants against defects in materials and workmanship for 90 days from the date of purchase, very distinct 10X magnified images, : E-Z UP SCSG13GY 13' Spectator Instant Shelter, AIMS Power 1000 Watt Pure Sine Inverter with Selectable 25/55 Amp Charger & Automatic Transfer Switch PIC100012120S. unconstrained or any activity burden. you can wake up the radio and the daily alarm. No sticky residue is left behind and certainly no repainting. IPCW CWG-MZ1107C0 Black Replacement Grille, SIZE L (6 INCH) FIT FOR: diameter 76~79cm, Easy to bring: the gauges are small in size.

American Shifter 106593 Black Shift Knob with M16 x 1.5 Insert Yellow General of The Army
Buy American Shifter 106593 Black Shift Knob with M16 x 1,5 Insert (Yellow General of The Army): Body - ✓ FREE DELIVERY possible on eligible purchases.