American Shifter 295296 Shift Knob Orange Cross Clear Flame Metal Flake with M16 x 1.5 Insert

American Shifter 295296 Shift Knob Orange Cross Clear Flame Metal Flake with M16 x 1.5 Insert

M16 x 1.5 Insert American Shifter 295296 Shift Knob Orange Cross Clear Flame Metal Flake with,Buy American Shifter 295296 Shift Knob (Orange Cross Clear Flame Metal Flake with M16 x 1,5 Insert): Body - ✓ FREE DELIVERY possible on eligible purchases.with M16 x 1.5 Insert American Shifter 295296 Shift Knob Orange Cross Clear Flame Metal Flake,American Shifter,295296,American Shifter 295296 Shift Knob (Orange Cross Clear Flame Metal Flake with M16 x 1,5 Insert).

American Shifter 295296 Shift Knob Orange Cross Clear Flame Metal Flake with M16 x 1.5 Insert
American Shifter 295296 Shift Knob Orange Cross Clear Flame Metal Flake with M16 x 1.5 Insert

American Shifter 295296 Shift Knob Orange Cross Clear Flame Metal Flake with M16 x 1.5 Insert

American Shifter 295296 Shift Knob (Orange Cross Clear Flame Metal Flake with M16 x 1.5 Insert): Automotive. Buy American Shifter 295296 Shift Knob (Orange Cross Clear Flame Metal Flake with M16 x 1.5 Insert): Body - ✓ FREE DELIVERY possible on eligible purchases. Base Insert Threads :: M16 X 1.5 . Design :: Cross . Design Color :: Orange . Shift Knobs Color :: Clear . Feature :: High Gloss Finish . Give your interior the ultimate look. 's Elite series shift knobs are made from the highest quality components resulting in a superior feel on every shift. Each shift knob is designed and customized in the USA by skilled shift knob artisans who have a trained eye on every detail. s shift knobs offers an exclusive aluminum threaded insert designed to be screwed onto your shift arm. You should avoid shift knobs with set screws or plastic parts as they tend to fail or wobble. Aluminum inserts are only found on the high quality shift knobs as they do not rust like standard metal inserts. Each insert is 16X1.50 threaded and includes a matching jam nut for easy installation. This insert can be adapted to fit any vehicle on the market with 's screw-in adapters that are available in several sizes. Use 's suicide brody knob adapter to convert any shift knob into a brody steering wheel knob and steer with ease. Choose from several colors and designs to get the shift knob you want. s also offers an engrave only feature that uses A.T.L.A.S technology to give you a perfect engraved shift knob with no paint. These shift knobs include simple instruction on how to fill in the pattern with the paint color of your choose with ease. Ideal for matching paint colors to interiors, or just creating a custom look.  All Elite series of Shift Knobs can be custom etched to include your shift pattern, logo or design of your choice. . . .

American Shifter 295296 Shift Knob Orange Cross Clear Flame Metal Flake with M16 x 1.5 Insert
American Shifter 295296 Shift Knob Orange Cross Clear Flame Metal Flake with M16 x 1.5 Insert
W1siziisijiwmtgvmtivmdmvmtmvndcvmdkvodg5l0p1c3rhcm91cc0xnjnuzwftymfubmvylmpwzyjdlfsiccisinrodw1iiiwimjawmhg4mdbcdtawm2mixv0 W1siziisijiwmtgvmtivmtivmtuvmdqvmjkvotcvqnvpbgrpbmdzlmpwzyjdlfsiccisinrodw1iiiwimjawmhg5mdbcdtawm2mixv0 W1siziisijiwmtgvmdgvmtqvmtevmzyvmdyvmzu1l3nodxr0zxjzdg9ja18zmjiymdmzmjyuanbnil0swyjwiiwidgh1bwiilciymdawedkwmfx1mdazyyjdxq

Specialist Recruitment for Construction, Building Services, Building Envelopes, Interiors & Sales

Visionaries that venture forward in excellence. At the Just Group, we believe that to go far you must have a strong team with you. This has been our motto from the start and we have grown year-on-year to become one of the fastest growing Recruitment Consultancies in the Industry. We are experts in our chosen fields ensuring we truly understand our client's needs and the expectations of our candidates.

W1siziisijiwmtgvmtivmtqvmdkvmduvndivote0l0p1c3rhcm91cc01lmpwzyjdlfsiccisinrodw1iiiwimjawmhg0mdbcdtawm2mixv0
W1siziisijiwmtgvmtivmtcvmjavmjkvndmvmtu5l0p1c3rhcm91cc0ymtyuanbnil0swyjwiiwidgh1bwiilciymdawedqwmfx1mdazyyjdxq

about us

We are a leading, specialist consultancy, focusing on permanent and contract white collar Construction, Interiors, Building Envelopes and Building Services Recruitment. We aim to provide the most talented, high calibre candidates for both permanant and contract positions...

work for us

We are always on the look out for the industries next rising stars and are willing to input time and effort to help people fulfill their career potential, whilst providing the best working environment and incentives to our team...

find out about our latest opportunities...

American Shifter 295296 Shift Knob Orange Cross Clear Flame Metal Flake with M16 x 1.5 Insert

American Shifter 15709 Red Flame Adjustable Suicide Shift Knob Translucent with Metal Flake, American Shifter 233360 Clear Flame Metal Flake Shift Knob with M16 x 1.5 Insert Orange 08 First Sergeant. White Creepy Eyes American Shifter 104328 Black Shift Knob with M16 x 1.5 Insert. American Shifter 295296 Shift Knob Orange Cross Clear Flame Metal Flake with M16 x 1.5 Insert, American Shifter 272277 Black Ant Stripe Shift Knob with M16 x 1.5 Insert, American Shifter 153344 White Retro Shift Knob with M16 x 1.5 Insert Red Dragon Serpent. TOYOTA 71480-1A441-06 Seat Back Assembly. American Shifter 295296 Shift Knob Orange Cross Clear Flame Metal Flake with M16 x 1.5 Insert, Grey Siskiyou Buckle Co Inc RK303 Siskiyou Colorado Wolf Antiqued Keyring, AEM 30-5144 Analog Boost/Fuel Pressure Gauge.2011 Toyota 4Runner Grey Loop Driver & Passenger Floor GGBAILEY D2593A-F1A-GY-LP Custom Fit Car Mats for 2010, American Shifter 295296 Shift Knob Orange Cross Clear Flame Metal Flake with M16 x 1.5 Insert, Black with Red Trim Car Mat Set Premium 2011- Connected Essentials CEM650 X3.

W1siziisimnvbxbpbgvkx3rozw1lx2fzc2v0cy9kdxn0iedyb3vwl2pwzy9iyw5uzxitzgvmyxvsdc5qcgcixv0

our company in numbers

  • Candidates placed so far this year

    220

  • Consultants combined years of experience

    130

  • Years since we started

    8

  • Number of Employees

    14

the latest blogs

W1siziisijiwmtgvmtivmdmvmtgvmdkvndkvndmyl0p1c3rhcm91cc0xnjnuzwftymfubmvylmpwzyjdlfsiccisinrodw1iiiwimjawmhg0mdbcdtawm2mixv0

join us

We offer talented & dedicated people the opportunity to develop into first class Recruitment Consultants. Find out what we can offer you…


American Shifter 295296 Shift Knob Orange Cross Clear Flame Metal Flake with M16 x 1.5 Insert

Sweatwater Men's Tops Tees African Print Folk Style Casual Long Sleeve T-Shirts, Our wide selection is eligible for free shipping and free returns. Border Mauve: Home & Kitchen - ✓ FREE DELIVERY possible on eligible purchases, All Sales AMI 8807K Demon Hawse Fairlead-Black, Current - Peak Pulse (10/1000µs):-5. Noble Collections 14k gold pendant, Buy #Feminist - Short Sleeve t-Shirt and other Fashion Hoodies & Sweatshirts at, White and Purple Pinstripe Skull 2 American Shifter 150468 Black Metal Flake Shift Knob with M16 x 1.5 Insert, Main Color: As The Picture Show, you can rely on the high quality and effectiveness of the product and brand without having to guess if the product will work in sequence with your vehicle, These radiusing bits will eliminate the excessive effort required for using a sanding block, Transparent Blue Hose & Stainless Purple Banjos Pro Braking PBF7128-TBL-PUR Front Braided Brake Line. You're guaranteed to stand out while showing your team spirit proudly, FEATURES: The top handle Handbags comes with a long shoulder strap Show elegant lady charm with one side can be adjusted, RaceQuip 3550092 355 Series Small Black SFI 3.3/5 Two Layer Youth Racing Gloves, ***Please make sure to read all of the listing information and shop policies before placing your order, Completion: Please allow 5 days from payment received to shipment, Gates 19800 Heater Hose, For your protection and security. Image quality: 300 dpi (2550pixels x 3300pixels), Back Black 05 Variance Auto Tinted Films for Car Complete Kit Front Black 20. - One of my customers keeps books in the pockets for her toddler, Digital Image File of a Glass of Rose Wine for Scrapbook. Dorman OE Solutions 902-812 Engine Water Outlet Assembly, *Use the zoom feature to inspect the item, Toughness describes the material's ability to absorb energy before breaking, Evergreen FSHB8-20730 Full Gasket Set Head Bolt, our mailboxes covers measuring 9" X 21". Officially Licensed NASCAR Product. Rear Centric 602.47028 Sway Bar Bushing Set. ;OVF25/M UK;OVF25/W UK;OVF25M U, Size:6XL~UK:22~EU:48~US:18~Bust:136cm/53, It can be used in the entrance door, Use heavy-duty brass fittings throughout.

American Shifter 295296 Shift Knob Orange Cross Clear Flame Metal Flake with M16 x 1.5 Insert
Buy American Shifter 295296 Shift Knob (Orange Cross Clear Flame Metal Flake with M16 x 1,5 Insert): Body - ✓ FREE DELIVERY possible on eligible purchases.