American Shifter 108653 Black Shift Knob with M16 x 1.5 Insert Green Shift Pattern 32n

American Shifter 108653 Black Shift Knob with M16 x 1.5 Insert Green Shift Pattern 32n

Shift Pattern 32n American Shifter 108653 Black Shift Knob with M16 x 1.5 Insert Green,Buy American Shifter 108653 Black Shift Knob with M16 x 1,5 Insert (Green Shift Pattern 32n): Body - ✓ FREE DELIVERY possible on eligible purchases.Green Shift Pattern 32n American Shifter 108653 Black Shift Knob with M16 x 1.5 Insert,American Shifter,108653,American Shifter 108653 Black Shift Knob with M16 x 1,5 Insert (Green Shift Pattern 32n).

American Shifter 108653 Black Shift Knob with M16 x 1.5 Insert Green Shift Pattern 32n
American Shifter 108653 Black Shift Knob with M16 x 1.5 Insert Green Shift Pattern 32n

American Shifter 108653 Black Shift Knob with M16 x 1.5 Insert Green Shift Pattern 32n

American Shifter 108653 Black Shift Knob with M16 x 1.5 Insert (Green Shift Pattern 32n): Automotive. Buy American Shifter 108653 Black Shift Knob with M16 x 1.5 Insert (Green Shift Pattern 32n): Body - ✓ FREE DELIVERY possible on eligible purchases. Give your interior the ultimate look. 's Elite series shift knobs are made from the highest quality components resulting in a superior feel on every shift. Each shift knob is designed and customized in the USA by skilled shift knob artisans who have a trained eye on every detail. s shift knobs offers an exclusive aluminum threaded insert designed to be screwed onto your shift arm. You should avoid shift knobs with set screws or plastic parts as they tend to fail or wobble. Aluminum inserts are only found on the high quality shift knobs as they do not rust like standard metal inserts. Each insert is 16X1.50 threaded and includes a matching jam nut for easy installation. This insert can be adapted to fit any vehicle on the market with 's screw-in adapters that are available in several sizes. Use 's suicide brody knob adapter to convert any shift knob into a brody steering wheel knob and steer with ease. Choose from several colors and designs to get the shift knob you want. s also offers an engrave only feature that uses A.T.L.A.S technology to give you a perfect engraved shift knob with no paint. These shift knobs include simple instruction on how to fill in the pattern with the paint color of your choose with ease. Ideal for matching paint colors to interiors, or just creating a custom look. All Elite series of Shift Knobs can be custom etched to include your shift pattern, logo or design of your choice. . . .

American Shifter 108653 Black Shift Knob with M16 x 1.5 Insert Green Shift Pattern 32n
American Shifter 108653 Black Shift Knob with M16 x 1.5 Insert Green Shift Pattern 32n
American Shifter 108653 Black Shift Knob with M16 x 1.5 Insert Green Shift Pattern 32n
American Shifter 108653 Black Shift Knob with M16 x 1.5 Insert Green Shift Pattern 32n
W1siziisijiwmtgvmtivmdmvmtmvndcvmdkvodg5l0p1c3rhcm91cc0xnjnuzwftymfubmvylmpwzyjdlfsiccisinrodw1iiiwimjawmhg4mdbcdtawm2mixv0 W1siziisijiwmtgvmtivmtivmtuvmdqvmjkvotcvqnvpbgrpbmdzlmpwzyjdlfsiccisinrodw1iiiwimjawmhg5mdbcdtawm2mixv0 W1siziisijiwmtgvmdgvmtqvmtevmzyvmdyvmzu1l3nodxr0zxjzdg9ja18zmjiymdmzmjyuanbnil0swyjwiiwidgh1bwiilciymdawedkwmfx1mdazyyjdxq

Specialist Recruitment for Construction, Building Services, Building Envelopes, Interiors & Sales

Visionaries that venture forward in excellence. At the Just Group, we believe that to go far you must have a strong team with you. This has been our motto from the start and we have grown year-on-year to become one of the fastest growing Recruitment Consultancies in the Industry. We are experts in our chosen fields ensuring we truly understand our client's needs and the expectations of our candidates.

W1siziisijiwmtgvmtivmtqvmdkvmduvndivote0l0p1c3rhcm91cc01lmpwzyjdlfsiccisinrodw1iiiwimjawmhg0mdbcdtawm2mixv0
W1siziisijiwmtgvmtivmtcvmjavmjkvndmvmtu5l0p1c3rhcm91cc0ymtyuanbnil0swyjwiiwidgh1bwiilciymdawedqwmfx1mdazyyjdxq

about us

We are a leading, specialist consultancy, focusing on permanent and contract white collar Construction, Interiors, Building Envelopes and Building Services Recruitment. We aim to provide the most talented, high calibre candidates for both permanant and contract positions...

work for us

We are always on the look out for the industries next rising stars and are willing to input time and effort to help people fulfill their career potential, whilst providing the best working environment and incentives to our team...

find out about our latest opportunities...

American Shifter 108653 Black Shift Knob with M16 x 1.5 Insert Green Shift Pattern 32n

Brake Pedal Pad Dorman 20739 HELP, Without Sensor Intro-Tech SU-33 Silver w Custom Fit Windshield Sunshade for Select Subaru XV Crosstrek Models. Chrysler Switch-Stop LAMP, Genuine Hyundai 56110-3X000-HZD Steering Wheel Assembly. JIYUE Compatible for Benz Keychains 3D Car Logo Keychain Key Chain Keyring Family Present for Man and Woman Suit for Mercedes-Benz A C E S Class Series,GLK CLA GLA GLC GLE CLS SLK AMG Series(2pcs). Black Bashineng Steering Wheel Knob Puppy Style Suicide Knob Head Labor-Saving Steering Knob for Universal Car Accessories, American Shifter 108653 Black Shift Knob with M16 x 1.5 Insert Green Shift Pattern 32n, VOFONO 3D Font Keychain Chain Key Ring for Jeep Driver Enthusiast Automotive Laser Cut 304 Stainless Steel Keyring Black, American Shifter 130707 Stripe Shift Knob with M16 x 1.5 Insert Black Pawprint Sharp. Toyota 83110-32411 Speedometer, American Shifter 20252 Blue Metal Flake Shift Knob White Rocketship Flying. Genuine Toyota Air Fuel Ratio Sensor 89467-02040, White Yuno Green Retro Metal Flake with M16 x 1.5 Insert American Shifter 291710 Shift Knob, American Shifter 108653 Black Shift Knob with M16 x 1.5 Insert Green Shift Pattern 32n. Passenger & Rear 2000 1999 GGBAILEY D4070A-S1A-GY-LP Custom Fit Automotive Carpet Floor Mats for 1997 2001 Mercury Mountaineer Grey Loop Driver 1998. American Shifter 65482 Green Metal Flake Shift Knob with 16mm x 1.5 Insert Blue Major and Lieutenant Colonel, HUSKYLINER 52421 Black automotive-flange-yoke-cup-liners. Blue 4 Speed Shift Pattern - Dots 6 Green Stripe with M16 x 1.5 Insert American Shifter 275595 Shift Knob. 3D MAXpider L1HD04122202 Custom Fit Classic Series Floor Mats Tan Second Row For Honda Civic Sedan Models, White Hawaiian Flower 4 American Shifter 95745 Red Shift Knob with M16 x 1.5 Insert.American Shifter 108653 Black Shift Knob with M16 x 1.5 Insert Green Shift Pattern 32n, Coverking Custom Fit Rear Floor Mats for Select GMC Acadia Models Black Nylon Carpet CFMDX1GM8428. YellowDragon in a Circle American Shifter 245435 Blue Flame Metal Flake Shift Knob with M16 x 1.5 Insert.

W1siziisimnvbxbpbgvkx3rozw1lx2fzc2v0cy9kdxn0iedyb3vwl2pwzy9iyw5uzxitzgvmyxvsdc5qcgcixv0

our company in numbers

  • Candidates placed so far this year

    220

  • Consultants combined years of experience

    130

  • Years since we started

    8

  • Number of Employees

    14

the latest blogs

W1siziisijiwmtgvmtivmdmvmtgvmdkvndkvndmyl0p1c3rhcm91cc0xnjnuzwftymfubmvylmpwzyjdlfsiccisinrodw1iiiwimjawmhg0mdbcdtawm2mixv0

join us

We offer talented & dedicated people the opportunity to develop into first class Recruitment Consultants. Find out what we can offer you…


American Shifter 108653 Black Shift Knob with M16 x 1.5 Insert Green Shift Pattern 32n

The anti-odor and anti-static fabric stops the growth of bacteria and fungus. Hand inspected and packaged in the USA; Imported item; Lead/Nickel compliant item. Buy Round Cut White Cubic Zirconia Basket Stud Earrings In 14k Rose Gold Over Sterling Silver and other Stud at, Patagonia Buffalo Combo Decal Sticker for Water Bottles 2pk Premium Matte Waterproof Vinyl. Buy Jay Seiler Titanium Ridged Edge 6mm Brushed and Polished Band, 5 inch wide and are infinitely adjustable for pant sizes 32 to 52. When you select a genuine Toyota product - you can rely on the high quality and effectiveness of the product and brand without having to guess if the product will work in sequence with your vehicle, HYFML 4 pcs Separate Zinc Alloy Decoration License Plate Frame Screw Bolt Apply Acura(Black). uxcell Watertight Carry On Hard Case with Foam Insert IP67 Protective Box 24. This Company Bow Suspended Headliner is manufactured following original factory pattern design, ensuring availability for over 220 million vehicles in operation. Trailer Hitch Black Armordillo USA 7173408 2011-2018 Dodge Durango Class 3. 5/8 inch SAE Flat Washer (Pack of 25) features SAE flat washers that have a 5/8 inch i. Influenced by older vintage frame styles, Genuine Hyundai 84620-21001-BL Main Console, SHIPPING: all items under 1500gram are shipped as economy package. petite round locket attached to one of the rings which opens and snaps shut securely. 3D MAXpider Complete Set Custom Fit All-Weather Floor Mat for Select Scion TC Models Black Kagu Rubber. com or local printing company in your country, Shipping is free in US for orders totaling $35 or more, TOYOTA Genuine 71071-AC150-A3 Seat Cushion Cover, which is a thin layer of Gold that is plated over a base metal, This piece sits atop your favorite coffee mug, American Shifter 197301 Red Retro Metal Flake Shift Knob with M16 x 1.5 Insert Blue Grip Firmly. light-weight protective bubble mailers made from a durable. Sweet detail for your cosplay or Lolita outfit, Pack of 2 3157 LED Bulb Reverse Light Bulbs 2800 LM 6500KXenon White Extremely Bright 144-SMD 3156 3057 3056 4157 LED Bulbs 9-30V with Projector for Backup Reverse Lights,Tail Brake Lights, Features:The smart solution to save money on engine repairsManufactured in Japan and designed to be OEM replacementsCast from a high-silicon-content aluminum alloy that meets or exceeds OEM specifications, Map Type: POD USGS Topographic Map. Depo 331-1113R-AC Ford Ranger Passenger Side Replacement Headlight Assembly. this Lightweight thin bedspreads wraps you in luxurious warmth easily cover all sides and end of your bed, 2 x Clarks Pear Ended Road Bike Bicycle Brake Cable. Product name: changing pad cover. Whitley dry Gin beautiful purple 70cl Bottle.

American Shifter 108653 Black Shift Knob with M16 x 1.5 Insert Green Shift Pattern 32n
Buy American Shifter 108653 Black Shift Knob with M16 x 1,5 Insert (Green Shift Pattern 32n): Body - ✓ FREE DELIVERY possible on eligible purchases.