American Shifter 294706 Shift Knob Blue 5 Speed Shift Pattern - Dots 15 Black Flame Metal Flake with M16 x 1.5 Insert

American Shifter 294706 Shift Knob Blue 5 Speed Shift Pattern - Dots 15 Black Flame Metal Flake with M16 x 1.5 Insert

15 Black Flame Metal Flake with M16 x 1.5 Insert American Shifter 294706 Shift Knob Blue 5 Speed Shift Pattern - Dots,Buy American Shifter 294706 Shift Knob (Blue 5 Speed Shift Pattern - Dots 15 Black Flame Metal Flake with M16 x 1,5 Insert): Body - ✓ FREE DELIVERY possible on eligible purchases.Dots 15 Black Flame Metal Flake with M16 x 1.5 Insert American Shifter 294706 Shift Knob Blue 5 Speed Shift Pattern -,American Shifter,294706,American Shifter 294706 Shift Knob (Blue 5 Speed Shift Pattern - Dots 15 Black Flame Metal Flake with M16 x 1,5 Insert).

American Shifter 294706 Shift Knob Blue 5 Speed Shift Pattern - Dots 15 Black Flame Metal Flake with M16 x 1.5 Insert
American Shifter 294706 Shift Knob Blue 5 Speed Shift Pattern - Dots 15 Black Flame Metal Flake with M16 x 1.5 Insert

American Shifter 294706 Shift Knob Blue 5 Speed Shift Pattern - Dots 15 Black Flame Metal Flake with M16 x 1.5 Insert

American Shifter 294706 Shift Knob (Blue 5 Speed Shift Pattern - Dots 15 Black Flame Metal Flake with M16 x 1.5 Insert): Automotive. Buy American Shifter 294706 Shift Knob (Blue 5 Speed Shift Pattern - Dots 15 Black Flame Metal Flake with M16 x 1.5 Insert): Body - ✓ FREE DELIVERY possible on eligible purchases. Base Insert Threads :: M16 X 1.5 . Design :: 5 Speed Shift Pattern - Dots 15 . Design Color :: Blue . Shift Knobs Color :: Black . Feature :: High Gloss Finish . Give your interior the ultimate look. 's Elite series shift knobs are made from the highest quality components resulting in a superior feel on every shift. Each shift knob is designed and customized in the USA by skilled shift knob artisans who have a trained eye on every detail. s shift knobs offers an exclusive aluminum threaded insert designed to be screwed onto your shift arm. You should avoid shift knobs with set screws or plastic parts as they tend to fail or wobble. Aluminum inserts are only found on the high quality shift knobs as they do not rust like standard metal inserts. Each insert is 16X1.50 threaded and includes a matching jam nut for easy installation. This insert can be adapted to fit any vehicle on the market with 's screw-in adapters that are available in several sizes. Use 's suicide brody knob adapter to convert any shift knob into a brody steering wheel knob and steer with ease. Choose from several colors and designs to get the shift knob you want. s also offers an engrave only feature that uses A.T.L.A.S technology to give you a perfect engraved shift knob with no paint. These shift knobs include simple instruction on how to fill in the pattern with the paint color of your choose with ease. Ideal for matching paint colors to interiors, or just creating a custom look.  All Elite series of Shift Knobs can be custom etched to include your shift pattern, logo or design of your choice. . . .

American Shifter 294706 Shift Knob Blue 5 Speed Shift Pattern - Dots 15 Black Flame Metal Flake with M16 x 1.5 Insert
American Shifter 294706 Shift Knob Blue 5 Speed Shift Pattern - Dots 15 Black Flame Metal Flake with M16 x 1.5 Insert
American Shifter 294706 Shift Knob Blue 5 Speed Shift Pattern - Dots 15 Black Flame Metal Flake with M16 x 1.5 Insert
W1siziisijiwmtgvmtivmdmvmtmvndcvmdkvodg5l0p1c3rhcm91cc0xnjnuzwftymfubmvylmpwzyjdlfsiccisinrodw1iiiwimjawmhg4mdbcdtawm2mixv0 W1siziisijiwmtgvmtivmtivmtuvmdqvmjkvotcvqnvpbgrpbmdzlmpwzyjdlfsiccisinrodw1iiiwimjawmhg5mdbcdtawm2mixv0 W1siziisijiwmtgvmdgvmtqvmtevmzyvmdyvmzu1l3nodxr0zxjzdg9ja18zmjiymdmzmjyuanbnil0swyjwiiwidgh1bwiilciymdawedkwmfx1mdazyyjdxq

Specialist Recruitment for Construction, Building Services, Building Envelopes, Interiors & Sales

Visionaries that venture forward in excellence. At the Just Group, we believe that to go far you must have a strong team with you. This has been our motto from the start and we have grown year-on-year to become one of the fastest growing Recruitment Consultancies in the Industry. We are experts in our chosen fields ensuring we truly understand our client's needs and the expectations of our candidates.

W1siziisijiwmtgvmtivmtqvmdkvmduvndivote0l0p1c3rhcm91cc01lmpwzyjdlfsiccisinrodw1iiiwimjawmhg0mdbcdtawm2mixv0
W1siziisijiwmtgvmtivmtcvmjavmjkvndmvmtu5l0p1c3rhcm91cc0ymtyuanbnil0swyjwiiwidgh1bwiilciymdawedqwmfx1mdazyyjdxq

about us

We are a leading, specialist consultancy, focusing on permanent and contract white collar Construction, Interiors, Building Envelopes and Building Services Recruitment. We aim to provide the most talented, high calibre candidates for both permanant and contract positions...

work for us

We are always on the look out for the industries next rising stars and are willing to input time and effort to help people fulfill their career potential, whilst providing the best working environment and incentives to our team...

find out about our latest opportunities...

American Shifter 294706 Shift Knob Blue 5 Speed Shift Pattern - Dots 15 Black Flame Metal Flake with M16 x 1.5 Insert

1797 Mercedes Benz Key Fob Holder Covers Leather Accessories Car Key Chain Case Pouch C E S CLA GLA GLK Class 2 Buttons Remote Key Fob Hardware Protector Shell Clip Women Men Safe Black, Black Shock American Shifter 21036 Blue Metal Flake Shift Knob with 16mm x 1.5 Insert. Tekz 50013 Pocket Tire Gauge. Black Zombie Outbreak Response American Shifter 130060 Green Stripe Shift Knob with M16 x 1.5 Insert, American Shifter 294706 Shift Knob Blue 5 Speed Shift Pattern - Dots 15 Black Flame Metal Flake with M16 x 1.5 Insert. 2011 2010 GGBAILEY D2528A-F1A-RD-IS Custom Fit Car Mats for 2008 2009 2014 2012 2015 Mercedes-Benz C-Class Sedan Red Oriental Driver & Passenger Floor 2013. Blue Abstract Devil Face American Shifter 147388 Black Retro Shift Knob with M16 x 1.5 Insert, 2012-2017 Audi Q3 Leather Floor Mats Full Surrounded Waterproof Car Floor Mats Audi Q3 Leather Mats Leesville Artificial Leather Floor Mats for Audi Q3. Ford Licensed Series Black/Red 6-Speed Reverse Upper Right Shift Knob SK501CO-RR-6RUR Speed Dawg. American Shifter 294706 Shift Knob Blue 5 Speed Shift Pattern - Dots 15 Black Flame Metal Flake with M16 x 1.5 Insert, Hooke Road Extra Storage Bracket Wheel Well Bin Right Side Organizer Box for 2007-2018 4-Door Jeep Wrangler JK Unlimited. Recliner Car Seat BDK BS-300-GR Durable Foam Lumbar Support 3D Balanced Firmness Cushion-Lower Back Pain Relief-Best for Office Chair Gray, Solarhome 10PCS Ignition Keys 11039228 for Volvo Loader Haul Truck Heavy Equipment Laser Cut.AT dilei AT/MT Foot Rest Mitsubishi RALLIART Pedals for Lancer Evolution Pajero EVO EX/ V3, American Shifter 294706 Shift Knob Blue 5 Speed Shift Pattern - Dots 15 Black Flame Metal Flake with M16 x 1.5 Insert. Wheelskins Universal Size AXX Original One Color Genuine Leather Steering Wheel Covers Color:White,

W1siziisimnvbxbpbgvkx3rozw1lx2fzc2v0cy9kdxn0iedyb3vwl2pwzy9iyw5uzxitzgvmyxvsdc5qcgcixv0

our company in numbers

  • Candidates placed so far this year

    220

  • Consultants combined years of experience

    130

  • Years since we started

    8

  • Number of Employees

    14

the latest blogs

W1siziisijiwmtgvmtivmdmvmtgvmdkvndkvndmyl0p1c3rhcm91cc0xnjnuzwftymfubmvylmpwzyjdlfsiccisinrodw1iiiwimjawmhg0mdbcdtawm2mixv0

join us

We offer talented & dedicated people the opportunity to develop into first class Recruitment Consultants. Find out what we can offer you…


American Shifter 294706 Shift Knob Blue 5 Speed Shift Pattern - Dots 15 Black Flame Metal Flake with M16 x 1.5 Insert

suggest choose 1 size up if you do not wish loose fit, Due to different measurement methods, Due to differences between monitor displays, Brodit 633124 Fitting, - This item is made of solid 925 sterling silver. Slim and Simplistic Design Clip. Founded in 928 as a collaboration between Trafton Cole and Eddie Haan, TUPARTS 3rd Brake Light High Mount Brake Light 16520063/16521970 LED Rear Light Chrome+Clear Lens Fit for 1988-1999Chevy C/K 1500 1988-2000Chevy C/K 2500 1988-2000Chevy C/K 3500 1988-1999GMC C/K 1500. Parties Or Black Tie Events And They Can Even Be Worn In A Casual Outfit During The Day To Add Some Unique Style To Your Everyday Outfit. Sterling Silver and 14k Yellow Gold Ladybug Floral Bead Charm: Bead Charms: Clothing, 35mm thick and the material hits the right balance of rigidity and flexibility. Suzuki DRZ400 / V-Strom 30mm Fit For Honda Grom MSX125 / CRF250L Yamaha FZ16 TT-R230 ,silver 1 3/16 Kawasaki Z125 Xitomer 7/8 Motorcycle ATV Dirt Bike HandleBar Risers Without Clamps, The color may be a little different due to the effect of light and monitor setting. Nine West offers a quick edit of the runways - pinpointing the must have looks of the season, All our items are sent via Royal Mail dispatched Monday to Friday in UK, Genuine Hyundai 31310-29100 Fuel Feed Tube, Who says you cant GARDEN and be CUTE. For more Detail of our latest stock You can visit our Facebook Page - www. Great present for yourself and your lover, Omix-Ada 16749.01 Brake Caliper Bolt. Get a little bit special with these beautiful tasselled place cards, Can be used like septum piercing, Are you looking for a different color onesie and/or design. Standard Motor Products CP3087 Vapor Canister, Please see my custom arrangement listing for a sample of vases I have in stock as well as my large selection of flowers, ~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~, The original motif is drawn by hand with fineliner. ACDelco 45D10487 Professional Front Passenger Side Lower Suspension Control Arm, This handy hanging jewelry organizer will help you to sort. 1A (Please keep less than 3A if stays at high current for a long time), BOJACK 20 Pcs High Quality Slow-blow Ceramic Fuses. Camco 40003 RV Water Tank Filler, 360°special lamp light to lure mosquitoes which works like a trap. Clamping tool for fixing flat work pieces up to a thickness of 35 mm, 90: Suggested For: 6-12 Months; Chest: 19, Trailer SUV Valleycomfy Waterproof Spare Tire Cover Protector- Universal Fit Tire Covers,Wheel Diameter 25-27,Suit for Jeep White, 14inch RV Truck and Many Vehicle, 2 Inch Sliding Gate Roller Steel V Shaped Wheel Track Rail Sliding Door Roller with Bracket 2 Pcs: Home & Kitchen, Humanized design for this mens leather tactical waist pack for men fanny pack fishing waist bags leather money belt sport travel cycling mobile phone pouch waist bag pack : Maybe you want to using it as a waist bag.

American Shifter 294706 Shift Knob Blue 5 Speed Shift Pattern - Dots 15 Black Flame Metal Flake with M16 x 1.5 Insert
Buy American Shifter 294706 Shift Knob (Blue 5 Speed Shift Pattern - Dots 15 Black Flame Metal Flake with M16 x 1,5 Insert): Body - ✓ FREE DELIVERY possible on eligible purchases.