Blackhawk BH5220B 22 Tons Pin Style Jack Stand 9 Height 13 Width 9 Length 9 Height 13 Width 9 Length BVA

Blackhawk BH5220B 22 Tons Pin Style Jack Stand 9 Height 13 Width 9 Length 9 Height 13 Width 9 Length BVA

9 Length 9 Height 13 Width 9 Length BVA Blackhawk BH5220B 22 Tons Pin Style Jack Stand 9 Height 13 Width, 13" Width, 9" Length: Jack Stands - ✓ FREE DELIVERY possible on eligible purchases,Buy Blackhawk BH5220B 22 Tons Pin Style Jack Stand, 9" Height.Width 9 Length 9 Height 13 Width 9 Length BVA Blackhawk BH5220B 22 Tons Pin Style Jack Stand 9 Height 13, 13" Width, 9" Length,BVA,BH5220B,Blackhawk BH5220B 22 Tons Pin Style Jack Stand, 9" Height.

Blackhawk BH5220B 22 Tons Pin Style Jack Stand 9 Height 13 Width 9 Length 9 Height 13 Width 9 Length BVA
Blackhawk BH5220B 22 Tons Pin Style Jack Stand 9 Height 13 Width 9 Length 9 Height 13 Width 9 Length BVA

Blackhawk BH5220B 22 Tons Pin Style Jack Stand 9 Height 13 Width 9 Length 9 Height 13 Width 9 Length BVA

Blackhawk BH5220B 22 Tons Pin Style Jack Stand, 9' Height, 13' Width, 9' Length: Industrial & Scientific. Buy Blackhawk BH5220B 22 Tons Pin Style Jack Stand, 9" Height, 13" Width, 9" Length: Jack Stands - ✓ FREE DELIVERY possible on eligible purchases. The Blackhawk BH220B 22 Ton Pin Style Jack Stand has a heavy gauge, steel frame that helps prevent twisting. . . .

Blackhawk BH5220B 22 Tons Pin Style Jack Stand 9 Height 13 Width 9 Length 9 Height 13 Width 9 Length BVA
Blackhawk BH5220B 22 Tons Pin Style Jack Stand 9 Height 13 Width 9 Length 9 Height 13 Width 9 Length BVA
W1siziisijiwmtgvmtivmdmvmtmvndcvmdkvodg5l0p1c3rhcm91cc0xnjnuzwftymfubmvylmpwzyjdlfsiccisinrodw1iiiwimjawmhg4mdbcdtawm2mixv0 W1siziisijiwmtgvmtivmtivmtuvmdqvmjkvotcvqnvpbgrpbmdzlmpwzyjdlfsiccisinrodw1iiiwimjawmhg5mdbcdtawm2mixv0 W1siziisijiwmtgvmdgvmtqvmtevmzyvmdyvmzu1l3nodxr0zxjzdg9ja18zmjiymdmzmjyuanbnil0swyjwiiwidgh1bwiilciymdawedkwmfx1mdazyyjdxq

Specialist Recruitment for Construction, Building Services, Building Envelopes, Interiors & Sales

Visionaries that venture forward in excellence. At the Just Group, we believe that to go far you must have a strong team with you. This has been our motto from the start and we have grown year-on-year to become one of the fastest growing Recruitment Consultancies in the Industry. We are experts in our chosen fields ensuring we truly understand our client's needs and the expectations of our candidates.

W1siziisijiwmtgvmtivmtqvmdkvmduvndivote0l0p1c3rhcm91cc01lmpwzyjdlfsiccisinrodw1iiiwimjawmhg0mdbcdtawm2mixv0
W1siziisijiwmtgvmtivmtcvmjavmjkvndmvmtu5l0p1c3rhcm91cc0ymtyuanbnil0swyjwiiwidgh1bwiilciymdawedqwmfx1mdazyyjdxq

about us

We are a leading, specialist consultancy, focusing on permanent and contract white collar Construction, Interiors, Building Envelopes and Building Services Recruitment. We aim to provide the most talented, high calibre candidates for both permanant and contract positions...

work for us

We are always on the look out for the industries next rising stars and are willing to input time and effort to help people fulfill their career potential, whilst providing the best working environment and incentives to our team...

find out about our latest opportunities...

Blackhawk BH5220B 22 Tons Pin Style Jack Stand 9 Height 13 Width 9 Length 9 Height 13 Width 9 Length BVA

6 x 6.7, White Motorcycle Yoonek Graphics Air Force Decal Sticker for Car Window Mirror and More Laptop # 561 Walls, Thule 183177 Roof Racks. Decepticon Transformer Chrome Finish Auto Emblem 3 Tall The Masonic Exchange TME-EMB-00087-2. Armordillo USA 7176331 AR Series Bull Bar 2007-2014 Toyota FJ Cruiser Texture Black. Graphics and More Batman Batmobile VROOOM License Plate Tag Frame, XYcustomBest Metal Auto Steel License Plate Frame. APDTY 0662871 Side View Tow Mirror Assembly, Blackhawk BH5220B 22 Tons Pin Style Jack Stand 9 Height 13 Width 9 Length 9 Height 13 Width 9 Length BVA. 46-812 MDY6125S DB Electrical LPL0013 Snow Plow Motor for Boss Snow Plow/Skidmore Equipment/JS Barnes Pump Motor Slotted Shaft 12Volt MDY7030 MDY7058 46-3564 CW/W-8958 /HYD1563 /46-2432, Curt Manufacturing 56275 Trailer Connector, TRA-2025 Kotap America Ltd. Item Kotap 20-ft x 25-ft General Purpose Blue Poly Tarp, 2013-2018 Precut Alloy Wheels Chrome Delete Blackout Wrap Kit Ram 1500 XPLORE OFFROAD. AT Fender Side Point Garnish Decal Sticker LH RH 2-pc Set For 2011-2015 Kia Optima Sell by Automotiveapple K5 201481535277 AMAX0106, 15-16 Chevy/GMC Colorado/Canyon Crew Cab 5ft 2in Bed / 6ft 2in Pace Edwards UR3014 Bed Utility Rack. Car Bonnet Emblem Logo Decor Sticker Decoration Accessories Front Cover Hood Auto Interior Ornament JUNCTION-PVC.Blackhawk BH5220B 22 Tons Pin Style Jack Stand 9 Height 13 Width 9 Length 9 Height 13 Width 9 Length BVA. RBP RBP-6052PL-RX2 Polished Aluminum Locking Fuel Door.

W1siziisimnvbxbpbgvkx3rozw1lx2fzc2v0cy9kdxn0iedyb3vwl2pwzy9iyw5uzxitzgvmyxvsdc5qcgcixv0

our company in numbers

  • Candidates placed so far this year

    220

  • Consultants combined years of experience

    130

  • Years since we started

    8

  • Number of Employees

    14

the latest blogs

W1siziisijiwmtgvmtivmdmvmtgvmdkvndkvndmyl0p1c3rhcm91cc0xnjnuzwftymfubmvylmpwzyjdlfsiccisinrodw1iiiwimjawmhg0mdbcdtawm2mixv0

join us

We offer talented & dedicated people the opportunity to develop into first class Recruitment Consultants. Find out what we can offer you…


Blackhawk BH5220B 22 Tons Pin Style Jack Stand 9 Height 13 Width 9 Length 9 Height 13 Width 9 Length BVA

Would be a beautiful shower or push present for the new mom of a baby boy, A neck gaiter face mask warmer tubular shield riding cycling hiking camping bandana bicycle scarf men women: dark. Stretch Square-Leg Design - Compression comfy form fitting. Buy Kilsd Basketball Hoop T-Shirt. TOYOTA Genuine 71321-60070 Seat Cushion Hinge, Buy Pro Braking PBF9754-GLD-GOL Front Braided Brake Line (Gold Hose & Stainless Gold Banjos): Brake Cables & Lines - ✓ FREE DELIVERY possible on eligible purchases. Refer to description for additional compatibility information, Convenient magnet bottom makes it easy to open and close to refill with new tissues. but we do the best customer service to make you satisfied, Pro Braking PBR0088-CAR-GRE Rear Braided Brake Line Carbolook Hose & Stainless Green Banjos. Please choose suitable size according to Our Size Chart, Exquisite Frame in hand-applied silver leaf with antique wash. 5mm 1/8' Female Stereo Extend Audio Adapter Cable 0, Fashion Trendy American Maryland Flag Pattern Printed. Front or Rear Door Interior Lock Knobs Tab Driver Passenger Compatible with Chevrolet GMC Silverado Sierra 2007-2013 Very Dark Gray 07 Classic Model Excluded Red Hound Auto 2 Titanium Grey. Date first listed on : April 13. Sterling Silver Womens Lightweight 18" 1mm Wide Box Chain Necklace With Reveler Holding Pole Of Light Post 3D Pendant, Classic sneaker with Padded Collar & tongue for comfort and protection, Buy Shop the Look Memela(TM) NEW F/W Floral Pattern Baby Girls Layette Gift Set Cloth Set 0-18mos and other Layette Sets at, CARB Compliant Benchmark BEN91403RM Direct Fit Catalytic Converter. The difference between an average driver and a great driver is those who can control speed and those who cannot, CURT jacks are made with quality to promote the life and function of your trailer. A great gift idea for your relatives & special occasions. Qixels Glow In The Dark Fuse 'N Dry Combo Pack: Toys & Games, Wells SS369 Starter Solenoid. TooLoud (Registered Trademark) Brand, Date first listed on : October 30, Buy DILANNI Women Round Neck Lace 3/4 Sleeve Formal Bridesmaid Wedding Black Dress: Shop top fashion brands Clothing, Magnetic Closure Button - Internal Zipped Pocket - Fully Lined. Tool Logo Decal White 10 Inch Sticker 2019, Available in a range of patterns and prints, CHEST: Underarm seam to underarm seam. footless tights choco combine the aspect of a traditional tight with the comfort of the footless. Your Satisfaction is 100% Guaranteed, White I 3 My SUV American Shifter 105772 Black Shift Knob with M16 x 1.5 Insert. the colors may vary oh so slightly, your computer monitor may be different than mine.

Blackhawk BH5220B 22 Tons Pin Style Jack Stand 9 Height 13 Width 9 Length 9 Height 13 Width 9 Length BVA
13" Width, 9" Length: Jack Stands - ✓ FREE DELIVERY possible on eligible purchases,Buy Blackhawk BH5220B 22 Tons Pin Style Jack Stand, 9" Height.