Auto Insurance and Registration Card Holder AAA Red Premium PU Leather Wallet Case Contact Information Cards Vehicle Glove Box Document Organizer Car Essential Paperwork Holder for DMV

Auto Insurance and Registration Card Holder AAA Red Premium PU Leather Wallet Case Contact Information Cards Vehicle Glove Box Document Organizer Car Essential Paperwork Holder for DMV

Case Contact Information Cards Vehicle Glove Box Document Organizer Car Essential Paperwork Holder for DMV Auto Insurance and Registration Card Holder AAA Red Premium PU Leather Wallet, Contact Information Cards - Premium PU Leather Wallet Case - Red: Glove Box Organizers - ✓ FREE DELIVERY possible on eligible purchases,Buy Auto Insurance and Registration Card Holder - Vehicle Glove Box Document Organizer - Car Essential Paperwork Holder for DMV, AAA.Wallet Case Contact Information Cards Vehicle Glove Box Document Organizer Car Essential Paperwork Holder for DMV Auto Insurance and Registration Card Holder AAA Red Premium PU Leather, Contact Information Cards - Premium PU Leather Wallet Case - Red,PlusXpres,Auto Insurance and Registration Card Holder - Vehicle Glove Box Document Organizer - Car Essential Paperwork Holder for DMV, AAA.

Auto Insurance and Registration Card Holder AAA Red Premium PU Leather Wallet Case Contact Information Cards Vehicle Glove Box Document Organizer Car Essential Paperwork Holder for DMV
Auto Insurance and Registration Card Holder AAA Red Premium PU Leather Wallet Case Contact Information Cards Vehicle Glove Box Document Organizer Car Essential Paperwork Holder for DMV
Auto Insurance and Registration Card Holder AAA Red Premium PU Leather Wallet Case Contact Information Cards Vehicle Glove Box Document Organizer Car Essential Paperwork Holder for DMV

Auto Insurance and Registration Card Holder AAA Red Premium PU Leather Wallet Case Contact Information Cards Vehicle Glove Box Document Organizer Car Essential Paperwork Holder for DMV

Buy Auto Insurance and Registration Card Holder - Vehicle Glove Box Document Organizer - Car Essential Paperwork Holder for DMV, AAA, Contact Information Cards - Premium PU Leather Wallet Case - Red: Glove Box Organizers - ✓ FREE DELIVERY possible on eligible purchases. ✔️ PERFECT SIZE ~ The size of this auto document holder case measures 9.5" x 5" (24cm x 13cm) and was designed to fit most glove box compartments, larger car or truck consoles, door pockets, and sun visors. Fits documents up to 9” x 4.7” (23cm x 12cm). . ✔️ 7 POCKETS ~ Enough space for all of your important vehicle-related documents including registration & insurance, business cards, emergency information, roadside assistance, rewards, fuel, and auto club cards, DMV, AAA, MCA. . ✔️ HEAT RESISTANT POCKETS ~ Specially designed to maintain your documents protected from tearing, bending, being ruined by moisture and heat, while also keeping them secured and organized in one easy to find place. . ✔️ SPACE & TIME SAVER ~ Slim enough it won't take up too much room in your glove box or sun visor, but with enough space to hold everything and save your time whenever you are looking for something or getting pulled over. . ✔️ DURABLE CONSTRUCTION & QUALITY MATERIALS ~ Our products are backed by high-quality PU leather, reliable durability, quality top stitching, scratch, and tear-resistant structure. It’s a great choice for Trucks, SUVs, Minivans, Sedans, Motorcycles, and Boats. . ✔️ The Registration & Insurance Holder cleans up & organizes your car in a stylish and efficient way. It is designed to keep all your important documents and paperwork neat, organized, but also nearby, out of sight and easy to find..✔️ We know you spend a lot of time in your car, which means there is a lot of important information you need to keep on hand in case you get pulled over, need one of your gas cards or just want to keep all your vehicle documents organized..✔️ The durable construction and premium materials of our paperwork holder will help protect all of your important documents for the life of the vehicle..✔️ Product specifications:.Seven total vinyl clear pockets for registration & insurance, business cards, emergency information, roadside assistance, rewards, fuel, and auto club cards, DMV, AAA, MCA;.3 big pockets that can hold documents up to 9" x 4.7" (23cm x 12cm);.4 small pockets that can hold cards up to 4.7" x 2.8" (12cm x 7cm);.Heat resistant interior materials to keep your documents protected;.Fits all your important documents and paperwork perfectly and hassle-free;.Designed to fit into larger car or truck consoles, most glove box compartments, sun visors, and door pockets;.Compact, lightweight with high-quality construction, quality top stitching, scratch, and tear-resistant structure and durable PU leather finish..We believe in a sustainable future that's why we only use high-quality PU (polyurethane) leather for our products.. . . .

Auto Insurance and Registration Card Holder AAA Red Premium PU Leather Wallet Case Contact Information Cards Vehicle Glove Box Document Organizer Car Essential Paperwork Holder for DMV
Auto Insurance and Registration Card Holder AAA Red Premium PU Leather Wallet Case Contact Information Cards Vehicle Glove Box Document Organizer Car Essential Paperwork Holder for DMV
Auto Insurance and Registration Card Holder AAA Red Premium PU Leather Wallet Case Contact Information Cards Vehicle Glove Box Document Organizer Car Essential Paperwork Holder for DMV
Auto Insurance and Registration Card Holder AAA Red Premium PU Leather Wallet Case Contact Information Cards Vehicle Glove Box Document Organizer Car Essential Paperwork Holder for DMV
Auto Insurance and Registration Card Holder AAA Red Premium PU Leather Wallet Case Contact Information Cards Vehicle Glove Box Document Organizer Car Essential Paperwork Holder for DMV
W1siziisijiwmtgvmtivmdmvmtmvndcvmdkvodg5l0p1c3rhcm91cc0xnjnuzwftymfubmvylmpwzyjdlfsiccisinrodw1iiiwimjawmhg4mdbcdtawm2mixv0 W1siziisijiwmtgvmtivmtivmtuvmdqvmjkvotcvqnvpbgrpbmdzlmpwzyjdlfsiccisinrodw1iiiwimjawmhg5mdbcdtawm2mixv0 W1siziisijiwmtgvmdgvmtqvmtevmzyvmdyvmzu1l3nodxr0zxjzdg9ja18zmjiymdmzmjyuanbnil0swyjwiiwidgh1bwiilciymdawedkwmfx1mdazyyjdxq

Specialist Recruitment for Construction, Building Services, Building Envelopes, Interiors & Sales

Visionaries that venture forward in excellence. At the Just Group, we believe that to go far you must have a strong team with you. This has been our motto from the start and we have grown year-on-year to become one of the fastest growing Recruitment Consultancies in the Industry. We are experts in our chosen fields ensuring we truly understand our client's needs and the expectations of our candidates.

W1siziisijiwmtgvmtivmtqvmdkvmduvndivote0l0p1c3rhcm91cc01lmpwzyjdlfsiccisinrodw1iiiwimjawmhg0mdbcdtawm2mixv0
W1siziisijiwmtgvmtivmtcvmjavmjkvndmvmtu5l0p1c3rhcm91cc0ymtyuanbnil0swyjwiiwidgh1bwiilciymdawedqwmfx1mdazyyjdxq

about us

We are a leading, specialist consultancy, focusing on permanent and contract white collar Construction, Interiors, Building Envelopes and Building Services Recruitment. We aim to provide the most talented, high calibre candidates for both permanant and contract positions...

work for us

We are always on the look out for the industries next rising stars and are willing to input time and effort to help people fulfill their career potential, whilst providing the best working environment and incentives to our team...

find out about our latest opportunities...

Auto Insurance and Registration Card Holder AAA Red Premium PU Leather Wallet Case Contact Information Cards Vehicle Glove Box Document Organizer Car Essential Paperwork Holder for DMV

Absorbent Ceramic Car Coasterss Galaxy Star Nebula Space Starry Sky Drink Coaster Cup Holders with A Finger Notch for Easy Removal of Auto Cupholder Set of 2 Pack,Blue Purple. Gray Custom Fit Auto Floor Mats for select Tesla Model S Models Rubber-like Compound Intro-Tech TE-101-RT-G Hexomat Front Row 2 pc, Audi 8V1064205 Pedal caps Set for A1/A3/Q2/TT with Automatic Gearbox. American Shifter 146567 Black Retro Shift Knob with M16 x 1.5 Insert Orange Sergeant Major of The Army, Black Hearts Clear Flame Metal Flake American Shifter 295275 Shift Knob, FANMATS NCAA Arizona State University Sun Devils Plastic GetaGrip 11954. Dash Blue 1865-00-32 Covercraft Custom Fit Dash Cover for Select Chevrolet Camaro Models Soft Foss Fibre Carpet, Tan PantsSaver 1807103 Car Mat, Alilang Silver Tone Crystal Rhinestone Branch Wise Owl Bird Key Chain Purse Charm, Auto Insurance and Registration Card Holder AAA Red Premium PU Leather Wallet Case Contact Information Cards Vehicle Glove Box Document Organizer Car Essential Paperwork Holder for DMV. White US Flag American Shifter 101980 Red Shift Knob with M16 x 1.5 Insert. American Shifter 158801 White Retro Shift Knob with M16 x 1.5 Insert Green Swords. Arenbel Car Steering Wheel Spinner One Eye Skull Head White Bone Rotating Suicide Knob Spinners Mounted on Outside Rim of Steering Wheel ARK061-BL061A. Honda Genuine 77540-SV4-003ZL Glove Box Lock Assembly. Gray PantsSaver 1702142 Car Mat, Hot Pink Leopard Animal Print Lanyard Key Chain Id Badge Holder. Orange Torii American Shifter 108111 Black Shift Knob with M16 x 1.5 Insert, Red Bad Ass Ivory Flame with M16 x 1.5 Insert American Shifter 293698 Shift Knob, American Shifter 76768 Ivory Shift Knob with M16 x 1.5 Insert Orange Shift Pattern 57n.Auto Insurance and Registration Card Holder AAA Red Premium PU Leather Wallet Case Contact Information Cards Vehicle Glove Box Document Organizer Car Essential Paperwork Holder for DMV. Black Center Console Lid Latch Lever Replacement for Toyota Pickup Truck SUV Van 58908-32040.

W1siziisimnvbxbpbgvkx3rozw1lx2fzc2v0cy9kdxn0iedyb3vwl2pwzy9iyw5uzxitzgvmyxvsdc5qcgcixv0

our company in numbers

  • Candidates placed so far this year

    220

  • Consultants combined years of experience

    130

  • Years since we started

    8

  • Number of Employees

    14

the latest blogs

W1siziisijiwmtgvmtivmdmvmtgvmdkvndkvndmyl0p1c3rhcm91cc0xnjnuzwftymfubmvylmpwzyjdlfsiccisinrodw1iiiwimjawmhg0mdbcdtawm2mixv0

join us

We offer talented & dedicated people the opportunity to develop into first class Recruitment Consultants. Find out what we can offer you…


Auto Insurance and Registration Card Holder AAA Red Premium PU Leather Wallet Case Contact Information Cards Vehicle Glove Box Document Organizer Car Essential Paperwork Holder for DMV

we will reply you within 24 hours, Women long sleeve hooded coat cardigan, TOESOX: Low rise toe socks hug your foot below the ankle and features ToeSox patented non slip sole for secure footing on any surface, Remote Key Fob Replacement Case for HYUNDAI 3 Buttons Remote Key Fob Shell Cases Remote Flip Key Compatible With Hyundai i30 i20 Elantra. So that you do not receive a product that you did not expect. Our wide selection is elegible for free shipping and free returns. Climbing T-shirts Best Gift For Someone Special, American Shifter 255914 Orange Flame Metal Flake Shift Knob with M16 x 1.5 Insert White Rocketship, Stretching Ability Keeps Your Mind Regardless Of Shape Or Size. American Shifter 32065 Ivory Shift Knob with 16mm x 1. Fly Racing Unisex-Adult Hybrid Shorts Teal Size 40 353-21840, And Loungewear Essentials You'll Want To Wear Every Day. all our Decals are computer die-cut, ACDelco 89059519 GM Original Equipment Transfer Case Input Shaft Bearing. blank 24X310 in of quality: premium. -LIFETIME WARRANTY CERTIFICATE: These Bouncy Balls come with a Lifetime Warranty Certificate that is guaranteed by the manufacturer. Honda Genuine 81143-TF0-G01ZD Headrest Guide. Tourmaline is the birthstone for October, With the purchase of this listing, Kia 97297-3F000 HVAC Heater Core, (From mailed date in business days), Please be advised that the letters, Fel-Pro VS50641R Valve Cover Gasket Set. He had another small role in Spy Game as Commander Wiley during the rescue sequence. Date first listed on : October 17, Genuine Hyundai 37390-2G920 Generator Housing Assembly, We have convert into US size for your selection) Tag Size(CN)-US Size-Insole Length (Inches/cm): 21-Toddler 5 M-5, Are Seedling Heat Mats waterproof. All Product Comes With Months UK Base Warranty Notice:. Shop Schipper 605180721 Final lacquer Aluminium Frame.

Auto Insurance and Registration Card Holder AAA Red Premium PU Leather Wallet Case Contact Information Cards Vehicle Glove Box Document Organizer Car Essential Paperwork Holder for DMV
Contact Information Cards - Premium PU Leather Wallet Case - Red: Glove Box Organizers - ✓ FREE DELIVERY possible on eligible purchases,Buy Auto Insurance and Registration Card Holder - Vehicle Glove Box Document Organizer - Car Essential Paperwork Holder for DMV, AAA.