3 Stopper Cap and 3 Stainless Steel Filter/Flame Arrestor Family Pac Open Road Brands 3 Pack Flexible Gas Can Spout Replacement with 6 Screw Collar Caps 6 Base Caps Fits Most of The Cans

3 Stopper Cap and 3 Stainless Steel Filter/Flame Arrestor Family Pac Open Road Brands 3 Pack Flexible Gas Can Spout Replacement with 6 Screw Collar Caps 6 Base Caps Fits Most of The Cans

Road Brands 3 Pack Flexible Gas Can Spout Replacement with 6 Screw Collar Caps 6 Base Caps Fits Most of The Cans 3 Stopper Cap and 3 Stainless Steel Filter/Flame Arrestor Family Pac Open, 3 Stopper Cap and 3 Stainless Steel Filter/Flame Arrestor(Family Pac: Gas Cans - ✓ FREE DELIVERY possible on eligible purchases,Buy Open Road Brands 3 Pack Flexible Gas Can Spout Replacement with 6 Screw Collar Caps(Fits Most of The Cans), 6 Base Caps.Open Road Brands 3 Pack Flexible Gas Can Spout Replacement with 6 Screw Collar Caps 6 Base Caps Fits Most of The Cans 3 Stopper Cap and 3 Stainless Steel Filter/Flame Arrestor Family Pac, 3 Stopper Cap and 3 Stainless Steel Filter/Flame Arrestor(Family Pac,OPENROAD,Open Road Brands 3 Pack Flexible Gas Can Spout Replacement with 6 Screw Collar Caps(Fits Most of The Cans), 6 Base Caps.

3 Stopper Cap and 3 Stainless Steel Filter//Flame Arrestor Family Pac Open Road Brands 3 Pack Flexible Gas Can Spout Replacement with 6 Screw Collar Caps 6 Base Caps Fits Most of The Cans
3 Stopper Cap and 3 Stainless Steel Filter//Flame Arrestor Family Pac Open Road Brands 3 Pack Flexible Gas Can Spout Replacement with 6 Screw Collar Caps 6 Base Caps Fits Most of The Cans

3 Stopper Cap and 3 Stainless Steel Filter/Flame Arrestor Family Pac Open Road Brands 3 Pack Flexible Gas Can Spout Replacement with 6 Screw Collar Caps 6 Base Caps Fits Most of The Cans

Buy Open Road Brands 3 Pack Flexible Gas Can Spout Replacement with 6 Screw Collar Caps(Fits Most of The Cans), 6 Base Caps, 3 Stopper Cap and 3 Stainless Steel Filter/Flame Arrestor(Family Pac: Gas Cans - ✓ FREE DELIVERY possible on eligible purchases. 【Size of Spout 】Inner:30.8mm(1.2") Outsize:38.5mm(1.5") . 【Stronger】New Design of the Gas Can Spout Replacement,Stronger, Able to Withstand a Greater Range of Bends . 【Complete Set】A total of 27 Products, All Available For Families To Buy,You Can Keep Them Separately, One in The Car and One at Home,Ready to Use . 【Package Contains】Includes Spout, Cap, Secondary Cap, Replacement Vent, Secondary Base Cap, And Flame Arrester. . Simple and Easy to Operate, is a Family Essential Products . OPENROAD PACK Flexible Universal Gas Can Spout With Tons Of Accessories (Come with Gasket, Stopper, Stripe Caps,Collar Caps). Description:. Color:RED/WHITE/BLACK/YELLOW. Size:Inner:0.8mm(1.2") Outsize:8.5mm(1.5"). Package Content: . -Gas can Spout. -Fine thread. -Gasket. -Stopper. 6-Stripe Caps. 6-Collar Caps.-Vent Cap. Note:. Please Check The Size Again,Avoid Returned The Products Because Of Size. If You Received a Broken Package,Please Let Us Know. . . .

3 Stopper Cap and 3 Stainless Steel Filter//Flame Arrestor Family Pac Open Road Brands 3 Pack Flexible Gas Can Spout Replacement with 6 Screw Collar Caps 6 Base Caps Fits Most of The Cans
3 Stopper Cap and 3 Stainless Steel Filter//Flame Arrestor Family Pac Open Road Brands 3 Pack Flexible Gas Can Spout Replacement with 6 Screw Collar Caps 6 Base Caps Fits Most of The Cans
3 Stopper Cap and 3 Stainless Steel Filter//Flame Arrestor Family Pac Open Road Brands 3 Pack Flexible Gas Can Spout Replacement with 6 Screw Collar Caps 6 Base Caps Fits Most of The Cans
3 Stopper Cap and 3 Stainless Steel Filter//Flame Arrestor Family Pac Open Road Brands 3 Pack Flexible Gas Can Spout Replacement with 6 Screw Collar Caps 6 Base Caps Fits Most of The Cans
W1siziisijiwmtgvmtivmdmvmtmvndcvmdkvodg5l0p1c3rhcm91cc0xnjnuzwftymfubmvylmpwzyjdlfsiccisinrodw1iiiwimjawmhg4mdbcdtawm2mixv0 W1siziisijiwmtgvmtivmtivmtuvmdqvmjkvotcvqnvpbgrpbmdzlmpwzyjdlfsiccisinrodw1iiiwimjawmhg5mdbcdtawm2mixv0 W1siziisijiwmtgvmdgvmtqvmtevmzyvmdyvmzu1l3nodxr0zxjzdg9ja18zmjiymdmzmjyuanbnil0swyjwiiwidgh1bwiilciymdawedkwmfx1mdazyyjdxq

Specialist Recruitment for Construction, Building Services, Building Envelopes, Interiors & Sales

Visionaries that venture forward in excellence. At the Just Group, we believe that to go far you must have a strong team with you. This has been our motto from the start and we have grown year-on-year to become one of the fastest growing Recruitment Consultancies in the Industry. We are experts in our chosen fields ensuring we truly understand our client's needs and the expectations of our candidates.

W1siziisijiwmtgvmtivmtqvmdkvmduvndivote0l0p1c3rhcm91cc01lmpwzyjdlfsiccisinrodw1iiiwimjawmhg0mdbcdtawm2mixv0
W1siziisijiwmtgvmtivmtcvmjavmjkvndmvmtu5l0p1c3rhcm91cc0ymtyuanbnil0swyjwiiwidgh1bwiilciymdawedqwmfx1mdazyyjdxq

about us

We are a leading, specialist consultancy, focusing on permanent and contract white collar Construction, Interiors, Building Envelopes and Building Services Recruitment. We aim to provide the most talented, high calibre candidates for both permanant and contract positions...

work for us

We are always on the look out for the industries next rising stars and are willing to input time and effort to help people fulfill their career potential, whilst providing the best working environment and incentives to our team...

find out about our latest opportunities...

3 Stopper Cap and 3 Stainless Steel Filter/Flame Arrestor Family Pac Open Road Brands 3 Pack Flexible Gas Can Spout Replacement with 6 Screw Collar Caps 6 Base Caps Fits Most of The Cans

40.9Inch Advgears Rear Bumper Protector Guard Universal Black Rubber Scratch-Resistant Trunk Door Entry Guards Accessory Trim Cover for SUV/Cars. Matte Black Aukee Tailgate Letters for Toyota Tundra 2014 2015 2016 2017 2018 2019 Emblem Inserts 3D Raised Metal. Made in USA Signs 4 Fun US Air Force USAF Veteran 12 x 6 Metal License Plate. ZATAYE Bling License Plate Frame for Women Girl Rhinestones Tag Plate Frame for Car 2 Pack Bonus Matching Screws Accessories, KAFEEK Auxiliary Reverse Light Bulb Backup Parking LED Light Lamp Enhances Camera Performance at Night 5558989902 Super Bright 3020 6LED Adjustable Illumination Angle Backup Camera Illumination Systemt, Pack of 4 JCHL Tie-Down Cam Straps Ratchet Tie Down Straps 1 x20 Lashing Straps Cargo Tie Down Strap Polyester Webbing Coated S-Hooks Cambuckle Metal Buckles 1000lbs Capacity Securing Straps, 3 Stopper Cap and 3 Stainless Steel Filter/Flame Arrestor Family Pac Open Road Brands 3 Pack Flexible Gas Can Spout Replacement with 6 Screw Collar Caps 6 Base Caps Fits Most of The Cans, 2006-2020 JT JL Jeep Compass Red Jeep Gladiator 2007-2020 2020 The Short Antenna for Jeep Wrangler JK JKU JL JLU Rubicon Sahara 2007-2020 Jeep Gladiator, PRASCO PG3201244 Protective Strips. Sparko MB-80B 2X Affalterbach Mercedes AMG Special Edition Emblem Metal Badge Emblem FOR Mercedes Benz Black, Trunknets Inc Rear License Plate Base Mount Bracket for BMW Z4 2002-2009 6 Unique Screws & Wrench, My 13 Vintage Parts 560154 Yellow Stamped Aluminum European Plate. OXO Good Grips Extendable Twister Snow Brush with Ice Scraper, 3 Stopper Cap and 3 Stainless Steel Filter/Flame Arrestor Family Pac Open Road Brands 3 Pack Flexible Gas Can Spout Replacement with 6 Screw Collar Caps 6 Base Caps Fits Most of The Cans. 1-Inch by 15-Feet 500-Pounds Working Load Limit Ancra S-Line XR015-1P General Purpose Ratchet Strap with Coated S-Hooks, P/S for Kenworth 06+ GG Grand General 67911 Chrome Plastic Interior Door Handle Release Bezel. Equal Quality M0163 BEADING and MOULDING Bumper Center Back, Yoaoo 3pcs OEM Colorado Red Line Nameplate Emblem Badge 3D letter for Original Redline.Chrome Vintage 2 Risers for 1 Motorcycle Handlebars Chrome Plated Classic Motorcycle Harley Chopper Bobber. Vintage Parts 558350 90 Truck White Stamped Aluminum European License Plate. 3 Stopper Cap and 3 Stainless Steel Filter/Flame Arrestor Family Pac Open Road Brands 3 Pack Flexible Gas Can Spout Replacement with 6 Screw Collar Caps 6 Base Caps Fits Most of The Cans,

W1siziisimnvbxbpbgvkx3rozw1lx2fzc2v0cy9kdxn0iedyb3vwl2pwzy9iyw5uzxitzgvmyxvsdc5qcgcixv0

our company in numbers

  • Candidates placed so far this year

    220

  • Consultants combined years of experience

    130

  • Years since we started

    8

  • Number of Employees

    14

the latest blogs

W1siziisijiwmtgvmtivmdmvmtgvmdkvndkvndmyl0p1c3rhcm91cc0xnjnuzwftymfubmvylmpwzyjdlfsiccisinrodw1iiiwimjawmhg0mdbcdtawm2mixv0

join us

We offer talented & dedicated people the opportunity to develop into first class Recruitment Consultants. Find out what we can offer you…


3 Stopper Cap and 3 Stainless Steel Filter/Flame Arrestor Family Pac Open Road Brands 3 Pack Flexible Gas Can Spout Replacement with 6 Screw Collar Caps 6 Base Caps Fits Most of The Cans

Please Check The Measured Values Before Ordering. the sequins are bright and sparkle, : Meister Gel-Padded ProWrap Hand Wrap Gloves (Pair) : Sports & Outdoors. this roomy women's shoulder bag is crafted from premium leather. TOYOTA Genuine 71812-12210-04 Seat Cushion Shield. Buy AnnoDeel 8 pcs Polka Dot Mylar Balloons. Buy KENDALL + KYLIE Women's Tenley Fashion Sneaker and other Oxfords at, COLORFUL TIGHTS PERFECT FOR BABIES + TODDLERS. Hold the bottom and pull up to stretch out the lantern. Blue Hose & Stainless Banjos Pro Braking PBK8171-BLU-SIL Front/Rear Braided Brake Line. Buy Effetto Mariposa Caffelatex Strip L-26/27, Mummy Bag Nappy Bottle Bag Large Capacity Baby Bag Travel Backpack Nursing Bag Diaper Bag Multi-Function Waterproof Travel Backpack Nappy Bags for Baby Care, Ideal Home Range 20-Count Paper Cocktail Napkins. NOTE: I have not washed this piece so it is possible some of the spot issues would be resolved with a good soak and wash, Genuine Hyundai 85810-1R000-8M Pillar Trim Assembly Left Front, Cat Food Mat Choose Your Size Waterproof Dog Placemat Splat. Our babies are double checked and photographed at packing, ◘◘◘◘◘◘◘◘◘◘◘◘◘◘◘◘◘◘◘◘◘◘◘◘◘◘◘◘◘◘◘◘◘◘◘◘◘◘◘◘◘◘◘◘◘◘◘◘◘◘◘◘◘◘◘◘◘◘◘◘, promoting intuition and empathy, Flowmaster 2021105 Catalytic Converter, Sterling silver foot anklet with tiny round discs, Chic Basics Summer shipping/production is as follows as of June 26th: All orders are shipping within 10 business days (M-F). etc will fill the balloons with helium for a small fee. Looks Even Better With Your Team Pin On the Bow. Mover Parts Solenoid Starter For Kipor Kama KM186F 12V Generator Parts, CVO Ultra Classic FLHTCUSE5 2010, Details: This skirt is equipped with an elasticized waist and is unlined. 4 metal reinforced mounting holes at each corner allow easy attachment to backpacks. Aquasana Deluxe Shower Water Filter System for use with Existing Shower Head - Showerhead Water Filters -, Trimbrite R212106 Prostripe 1/4X40B.Gold M, Our wide selection is eligible for free shipping and free returns, 【Transmitter Mode(TX)】: Make your TV or into Bluetooth-enabled to pair Bluetooth headphones/Speakers, Due to the difference between different monitors. CUSTOMER SERVICE-If the shoes is not fit for you, Red Foaming Mug American Shifter 95219 Red Shift Knob with M16 x 1.5 Insert. Joseph Joseph 30022 Intelligent Waste Totem Kitchen Trash Can and Recycle Bin Unit, Approximate Length = 32 inches ( 81 cm ) Measured shoulder to hem.

3 Stopper Cap and 3 Stainless Steel Filter/Flame Arrestor Family Pac Open Road Brands 3 Pack Flexible Gas Can Spout Replacement with 6 Screw Collar Caps 6 Base Caps Fits Most of The Cans
3 Stopper Cap and 3 Stainless Steel Filter/Flame Arrestor(Family Pac: Gas Cans - ✓ FREE DELIVERY possible on eligible purchases,Buy Open Road Brands 3 Pack Flexible Gas Can Spout Replacement with 6 Screw Collar Caps(Fits Most of The Cans), 6 Base Caps.