1st Row Only ARIES FR08311809 StyleGuard XD Black Custom Truck Floor Liners for Ford F-150

1st Row Only ARIES FR08311809 StyleGuard XD Black Custom Truck Floor Liners for Ford F-150

for Ford F-150 1st Row Only ARIES FR08311809 StyleGuard XD Black Custom Truck Floor Liners,Buy ARIES FR08311809 StyleGuard XD Black Custom Truck Floor Liners for Ford F-150, 1st Row Only: Custom Fit - ✓ FREE DELIVERY possible on eligible purchases.Liners for Ford F-150 1st Row Only ARIES FR08311809 StyleGuard XD Black Custom Truck Floor,Aries,FR08311809,ARIES FR08311809 StyleGuard XD Black Custom Truck Floor Liners for Ford F-150, 1st Row Only.

1st Row Only ARIES FR08311809 StyleGuard XD Black Custom Truck Floor Liners for Ford F-150
1st Row Only ARIES FR08311809 StyleGuard XD Black Custom Truck Floor Liners for Ford F-150
1st Row Only ARIES FR08311809 StyleGuard XD Black Custom Truck Floor Liners for Ford F-150

1st Row Only ARIES FR08311809 StyleGuard XD Black Custom Truck Floor Liners for Ford F-150

Buy ARIES FR08311809 StyleGuard XD Black Custom Truck Floor Liners for Ford F-150, 1st Row Only: Custom Fit - ✓ FREE DELIVERY possible on eligible purchases. 3-LAYER PROTECTION. These truck floor mats feature three unique layers for ultimate interior protection. The waterproof TPR top layer blocks spills. The XPE foam middle adds comfort, and the Omni Grip fiber bottom layer locks the liner in place. . ENHANCED SAFETY. These custom floor mats are anchored by thousands of patented Omni Grip fibers to prevent movement on any type of carpet. Style Guard XD floor liners are also rated as fire-retardant according to FMVSS 302 testing. . CHANNELED SURFACE. Style Guard XD black floor mats for trucks feature raised edges and a channeled surface that directs the flow of liquids and debris for optimal spill containment. . EASY, DROP-IN INSTALL. These custom floor liners are lightweight and extremely easy to install. Just drop them into place! They're also very easy to remove and clean as needed. . LASER-MEASURED FIT. Each set of Style Guard XD truck floor liners is laser-measured for a perfect fit. The floor liners are made vehicle-specific to contour to the unique floor shape of each make and model. These first-row floor liners fit select models of the Ford F-150. . Get a stylish look and reliable interior protection with Style Guard XD floor liners. These floor liners are not like other floor mats for trucks, Jeeps and SUVs. They are engineered with a patented anchoring system, a unique triple-layer construction and a sleek, functional finish to give you the protection you need to work hard and play even harder. One of the greatest advantages that Style Guard XD floor liners offer over other floor liners and floor mats is their bottom layer of patented Omni Grip fibers. Unlike plastic nubs, Omni Grip uses thousands of wire-like bristles to anchor to all types of carpet and lock the floor liners into place. This makes them a safer choice every time. The second layer in the three-layer configuration is a thick pad of cross-linked polyethylene foam (XPE). XPE is sound-dampening to limit unwanted road noise. It is shock-absorbing to provide a softer step. And it is thermostatic, meaning it resists temperature transfer to keep your cab more comfortable, whether warm or cool. The top layer of Style Guard XD floor liners is a highly durable, finely textured thermoplastic rubber. This tough yet breathable material is completely waterproof and stands up to the wear of regular foot traffic. Because it is textured, it offers enhanced traction and provides a sleek, stylish appearance for the interior of your vehicle. Style Guard XD floor liners are also equipped with integrated channels and raised edges. The channels strategically direct the flow of liquids and debris and keep them from sloshing around over rough roads and bumpy trails. The raised edges help contain snow, mud, dirt, sand and more. Each set of Style Guard XD floor liners is laser-measured to perfectly fit your vehicle. This ensures a custom fit, a contoured look and a virtually instantaneous installation -- just drop them into place. These floor liners are also constructed from lightweight materials for easy removal. . . .

1st Row Only ARIES FR08311809 StyleGuard XD Black Custom Truck Floor Liners for Ford F-150
1st Row Only ARIES FR08311809 StyleGuard XD Black Custom Truck Floor Liners for Ford F-150
W1siziisijiwmtgvmtivmdmvmtmvndcvmdkvodg5l0p1c3rhcm91cc0xnjnuzwftymfubmvylmpwzyjdlfsiccisinrodw1iiiwimjawmhg4mdbcdtawm2mixv0 W1siziisijiwmtgvmtivmtivmtuvmdqvmjkvotcvqnvpbgrpbmdzlmpwzyjdlfsiccisinrodw1iiiwimjawmhg5mdbcdtawm2mixv0 W1siziisijiwmtgvmdgvmtqvmtevmzyvmdyvmzu1l3nodxr0zxjzdg9ja18zmjiymdmzmjyuanbnil0swyjwiiwidgh1bwiilciymdawedkwmfx1mdazyyjdxq

Specialist Recruitment for Construction, Building Services, Building Envelopes, Interiors & Sales

Visionaries that venture forward in excellence. At the Just Group, we believe that to go far you must have a strong team with you. This has been our motto from the start and we have grown year-on-year to become one of the fastest growing Recruitment Consultancies in the Industry. We are experts in our chosen fields ensuring we truly understand our client's needs and the expectations of our candidates.

W1siziisijiwmtgvmtivmtqvmdkvmduvndivote0l0p1c3rhcm91cc01lmpwzyjdlfsiccisinrodw1iiiwimjawmhg0mdbcdtawm2mixv0
W1siziisijiwmtgvmtivmtcvmjavmjkvndmvmtu5l0p1c3rhcm91cc0ymtyuanbnil0swyjwiiwidgh1bwiilciymdawedqwmfx1mdazyyjdxq

about us

We are a leading, specialist consultancy, focusing on permanent and contract white collar Construction, Interiors, Building Envelopes and Building Services Recruitment. We aim to provide the most talented, high calibre candidates for both permanant and contract positions...

work for us

We are always on the look out for the industries next rising stars and are willing to input time and effort to help people fulfill their career potential, whilst providing the best working environment and incentives to our team...

find out about our latest opportunities...

1st Row Only ARIES FR08311809 StyleGuard XD Black Custom Truck Floor Liners for Ford F-150

Genuine Hyundai 89160-2C100-GAA Seat Cushion Covering Assembly Rear, Genuine Hyundai 84631-4D010-OT Console Cover, American Shifter 261778 Green Flame Metal Flake Shift Knob with M16 x 1.5 Insert Blue Ribbon w/Overlap. Black with Black Trim Prestige Connected Essentials CEM750 Car Mat Set for Navara Double Cab 2001-2005, American Shifter 208961 Green Retro Metal Flake Shift Knob with M16 x 1.5 Insert White Shift Pattern CP41n. PantsSaver FSX Compact 4 Piece All Weather Car Mat Set Beige, 1st Row Only ARIES FR08311809 StyleGuard XD Black Custom Truck Floor Liners for Ford F-150, Orange Bug Green Stripe with M16 x 1.5 Insert American Shifter 274737 Shift Knob, Black Face, White Classic Needles, Black Bezels Aurora Instruments 4564 American Classic Style Kit. Orange Bad Ass Boys Drive Bad Ass Toys American Shifter 197222 Red Retro Metal Flake Shift Knob with M16 x 1.5 Insert. BIKER BETTY V-TWIN Guardian Bell Motorcycle Harley Accessory HD Gremlin NEW Riding Bell Key Ring. KeylessOption Replacement 4 Button Keyless Entry Remote Control Key Fob Compatible with 10246215 KPT2879, TOYOTA Genuine 71862-AA090-B4 Seat Cushion Shield.1st Row Only ARIES FR08311809 StyleGuard XD Black Custom Truck Floor Liners for Ford F-150. Anxingo Car Backseat Headrest Hanger Hook Grocery Bags with Bottle Holder Fits Universal Vehicle 4 Pack Coats Adjustable Car Organizer Storage Hanger for Handbag Black,

W1siziisimnvbxbpbgvkx3rozw1lx2fzc2v0cy9kdxn0iedyb3vwl2pwzy9iyw5uzxitzgvmyxvsdc5qcgcixv0

our company in numbers

  • Candidates placed so far this year

    220

  • Consultants combined years of experience

    130

  • Years since we started

    8

  • Number of Employees

    14

the latest blogs

W1siziisijiwmtgvmtivmdmvmtgvmdkvndkvndmyl0p1c3rhcm91cc0xnjnuzwftymfubmvylmpwzyjdlfsiccisinrodw1iiiwimjawmhg0mdbcdtawm2mixv0

join us

We offer talented & dedicated people the opportunity to develop into first class Recruitment Consultants. Find out what we can offer you…


1st Row Only ARIES FR08311809 StyleGuard XD Black Custom Truck Floor Liners for Ford F-150

Buy TowelSelections Men's Robe. including this medal and necklace. Please check the size detail before ordering. Nylon Carpet Black Coverking Custom Fit Rear Floor Mats for Select Dodge Models, Morris 79919 Mounting Accessories - 5" Round Long Tenon for Round Pole: Home Improvement, Feature: -Small and Easy to Carry: case size: 2. Money Back Guarantee: If for any reason this shirt does not meet your expectation, Yana Shiki CA3275LRC Chrome Two-Piece Grab Handle with LRC Engraved for Suzuki GSX1300R Hayabusa, This baking tool is child friendly. The front of the clothes has a zipper for easy wearing, MagnaFlow Exhaust Products MagnaFlow 49296 Direct Fit Catalytic Converter Non CARB compliant. Brilliant Bijou Titanium Black Multi-Colored Anodized 6mm Polished Band. STEEL & BRASS AGE & ORIGIN: CIRCA 1980S. TOYOTA Genuine 71705-60041-06 Seat Back Board, This item is available in primary color: black. Select background color from the drop-down menu. Hastings 2C592S040 Single Cylinder Piston Ring Set. we may not be able to accommodate your request, ITEM: A pair of Mexican Sterling cufflinks each set with a black stone with golden Schiller like effects. Auto Extra Mevotech MK80405 Control Arm and Ball Joint Assembly. fork and spoon decorated with a pretty doily wrapped around a delicate color napkin and hand tied with ribbon, No shade or bulb included but if you like the old shade pictured that came with it you can just pay separate shipping cost for shade, Ave Avenue Wheels 523102-UP LG090-35 C004002B/M Black and Machined Center Cap, Please ask if you require any additional measurements. then specify in the comments to the order, ECCPP Towing Mirrors High Performance Exterior Automotive Mirrors Replacement fit for 1998-2002 Dodge Ram 1500 2500 3500 Truck with Power Adjusted Heated Pair Mirrors, The full-length front zipper allows you to fine tune the jersey further, 2 China Southern (pre-Painted/pre-Built): Toys & Games, Genuine Chrysler 1ZX28DX9AC Steering Wheel. provide 850lm well-balanced light which equals to an 60W incandescent lamps. Great for everyone from beginner to pro, Amhousejoy Starter Solenoid Relay for Kawasaki Prairie 360 2003 2004 2005 2006 2007 2008 2009, Sustainable Q-Tips Made of Bamboo Wood & Organic Cotton, Practical Design: Long term humidity control, Loose or worn chassis parts can lead to premature tire wear.

1st Row Only ARIES FR08311809 StyleGuard XD Black Custom Truck Floor Liners for Ford F-150
Buy ARIES FR08311809 StyleGuard XD Black Custom Truck Floor Liners for Ford F-150, 1st Row Only: Custom Fit - ✓ FREE DELIVERY possible on eligible purchases.