Magnetic Mount Benuo Universal Air Vent Car Cell Phone Holder with Strong Absorption Metal Plate for iPhone Xs Max,Xs,Xr,X,8 Plus,8,7 Plus,7,6S,6 Plus,6,5s,5,4s,4 Galaxy LG Sony Mini Tablet etc.

Magnetic Mount Benuo Universal Air Vent Car Cell Phone Holder with Strong Absorption Metal Plate for iPhone Xs Max,Xs,Xr,X,8 Plus,8,7 Plus,7,6S,6 Plus,6,5s,5,4s,4 Galaxy LG Sony Mini Tablet etc.

Absorption Metal Plate for iPhone Xs Max,Xs,Xr,X,8 Plus,8,7 Plus,7,6S,6 Plus,6,5s,5,4s,4 Galaxy LG Sony Mini Tablet etc. Magnetic Mount Benuo Universal Air Vent Car Cell Phone Holder with Strong,X,8 Plus,8,7 Plus,7,6S,6 Plus,6,5s,5,4s,4 Galaxy LG Sony Mini Tablet etc,: Benuo Official,Magnetic Mount, Benuo Universal Air Vent Car Cell Phone Holder with Strong Absorption Metal Plate for iPhone Xs Max,Xs,Xr.Strong Absorption Metal Plate for iPhone Xs Max,Xs,Xr,X,8 Plus,8,7 Plus,7,6S,6 Plus,6,5s,5,4s,4 Galaxy LG Sony Mini Tablet etc. Magnetic Mount Benuo Universal Air Vent Car Cell Phone Holder with,Xs,Xr,X,8 Plus,8,7 Plus,7,6S,6 Plus,6,5s,5,4s,4 Galaxy LG Sony Mini Tablet etc,Benuo,18791312,Magnetic Mount, Benuo Universal Air Vent Car Cell Phone Holder with Strong Absorption Metal Plate for iPhone Xs Max.

Magnetic Mount Benuo Universal Air Vent Car Cell Phone Holder with Strong Absorption Metal Plate for iPhone Xs Max,Xs,Xr,X,8 Plus,8,7 Plus,7,6S,6 Plus,6,5s,5,4s,4 Galaxy LG Sony Mini Tablet etc.
Magnetic Mount Benuo Universal Air Vent Car Cell Phone Holder with Strong Absorption Metal Plate for iPhone Xs Max,Xs,Xr,X,8 Plus,8,7 Plus,7,6S,6 Plus,6,5s,5,4s,4 Galaxy LG Sony Mini Tablet etc.
Magnetic Mount Benuo Universal Air Vent Car Cell Phone Holder with Strong Absorption Metal Plate for iPhone Xs Max,Xs,Xr,X,8 Plus,8,7 Plus,7,6S,6 Plus,6,5s,5,4s,4 Galaxy LG Sony Mini Tablet etc.

Magnetic Mount Benuo Universal Air Vent Car Cell Phone Holder with Strong Absorption Metal Plate for iPhone Xs Max,Xs,Xr,X,8 Plus,8,7 Plus,7,6S,6 Plus,6,5s,5,4s,4 Galaxy LG Sony Mini Tablet etc.

Magnetic Mount, Benuo Universal Air Vent Car Cell Phone Holder with Strong Absorption Metal Plate for iPhone Xs Max,Xs,Xr,X,8 Plus,8,7 Plus,7,6S,6 Plus,6,5s,5,4s,4 Galaxy LG Sony Mini Tablet etc.: Benuo Official. ELEGANT & UNIQUE RECTANGLE DESIGN: Different with the most circular design in market, our magnetic car phone holder adopts the unique rectangle design, giving your dashboard a stylish and luxurious look and versatile viewing. Highly-flexible rotation provides infinite viewing angles. Position your phone at the perfect angle to enjoy a more relaxed and safer drive. . STURDY CAR MOUNT: 2 reinforced claw allow a perfect fit with almost any straight blades air vents. The rubberized exterior increase grip which guaranteed the base of the mount can hold in your car air vent solidly and keep your car’s air vent scratch-free. Easily one-hand slip into the air vent and remove without any tools. . SECURE MAGNETIC PHONE HOLDER: 4 powerful magnets form a cyclic closed magnetic field, improving the degaussing effect without disturbing the phone’s signal. They are evenly distributed under the smooth and soft silicone surface to absorb your cell phone firmly which ensure your iPhone in good condiction, regardless of road vibrations or impacts. Perfectly suitable for mounting and holding any phone in place. Just no worry your phone would fall off suddenly when driving. . COMPACT CAR PHONE MOUNT: Magnetic design means, no cradles, brackets, clamps or gel and sticky residue. Eliminates the unsightly features of most car mounts. (NOTE: Metal plates will interfere with wireless charging capabilities, pls remove the metal plate before using a wireless charge) Support all the smartphones and iPod Touch, Mini PC, GPS navigator and so on. . UNIVERSAL COMPATIBILITY: Lifetime Warranty. The package equipped with one curcial matal plate with 3M adhesive and one rectangular metal plate, the circular plate can fit the phone without case and the other one can fit either with case or without case. (NOTE: Thicker phone cases may interfere with magnetic adhesion, pls just attach the circular metal plate with 3M adhesive on the phone case directly for better absorption.) .

Magnetic Mount Benuo Universal Air Vent Car Cell Phone Holder with Strong Absorption Metal Plate for iPhone Xs Max,Xs,Xr,X,8 Plus,8,7 Plus,7,6S,6 Plus,6,5s,5,4s,4 Galaxy LG Sony Mini Tablet etc.
Magnetic Mount Benuo Universal Air Vent Car Cell Phone Holder with Strong Absorption Metal Plate for iPhone Xs Max,Xs,Xr,X,8 Plus,8,7 Plus,7,6S,6 Plus,6,5s,5,4s,4 Galaxy LG Sony Mini Tablet etc.
Magnetic Mount Benuo Universal Air Vent Car Cell Phone Holder with Strong Absorption Metal Plate for iPhone Xs Max,Xs,Xr,X,8 Plus,8,7 Plus,7,6S,6 Plus,6,5s,5,4s,4 Galaxy LG Sony Mini Tablet etc.
Magnetic Mount Benuo Universal Air Vent Car Cell Phone Holder with Strong Absorption Metal Plate for iPhone Xs Max,Xs,Xr,X,8 Plus,8,7 Plus,7,6S,6 Plus,6,5s,5,4s,4 Galaxy LG Sony Mini Tablet etc.
Magnetic Mount Benuo Universal Air Vent Car Cell Phone Holder with Strong Absorption Metal Plate for iPhone Xs Max,Xs,Xr,X,8 Plus,8,7 Plus,7,6S,6 Plus,6,5s,5,4s,4 Galaxy LG Sony Mini Tablet etc.
W1siziisijiwmtgvmtivmdmvmtmvndcvmdkvodg5l0p1c3rhcm91cc0xnjnuzwftymfubmvylmpwzyjdlfsiccisinrodw1iiiwimjawmhg4mdbcdtawm2mixv0 W1siziisijiwmtgvmtivmtivmtuvmdqvmjkvotcvqnvpbgrpbmdzlmpwzyjdlfsiccisinrodw1iiiwimjawmhg5mdbcdtawm2mixv0 W1siziisijiwmtgvmdgvmtqvmtevmzyvmdyvmzu1l3nodxr0zxjzdg9ja18zmjiymdmzmjyuanbnil0swyjwiiwidgh1bwiilciymdawedkwmfx1mdazyyjdxq

Specialist Recruitment for Construction, Building Services, Building Envelopes, Interiors & Sales

Visionaries that venture forward in excellence. At the Just Group, we believe that to go far you must have a strong team with you. This has been our motto from the start and we have grown year-on-year to become one of the fastest growing Recruitment Consultancies in the Industry. We are experts in our chosen fields ensuring we truly understand our client's needs and the expectations of our candidates.

W1siziisijiwmtgvmtivmtqvmdkvmduvndivote0l0p1c3rhcm91cc01lmpwzyjdlfsiccisinrodw1iiiwimjawmhg0mdbcdtawm2mixv0
W1siziisijiwmtgvmtivmtcvmjavmjkvndmvmtu5l0p1c3rhcm91cc0ymtyuanbnil0swyjwiiwidgh1bwiilciymdawedqwmfx1mdazyyjdxq

about us

We are a leading, specialist consultancy, focusing on permanent and contract white collar Construction, Interiors, Building Envelopes and Building Services Recruitment. We aim to provide the most talented, high calibre candidates for both permanant and contract positions...

work for us

We are always on the look out for the industries next rising stars and are willing to input time and effort to help people fulfill their career potential, whilst providing the best working environment and incentives to our team...

find out about our latest opportunities...

Magnetic Mount Benuo Universal Air Vent Car Cell Phone Holder with Strong Absorption Metal Plate for iPhone Xs Max,Xs,Xr,X,8 Plus,8,7 Plus,7,6S,6 Plus,6,5s,5,4s,4 Galaxy LG Sony Mini Tablet etc.

2020 Version 2 and 1 Audio and Charge Ami Cable MMI Adapter Cord for Audi and VW Car Compatible with Phone 11 Pro /11/XS/Max/X/ 8/7 /6 /6s /Plus /5, Uvital 200 Pack UG Quick Wire Splice connectors Standard Scotchlok UG K5 Sealed Communication Connector. 5.25 inches-Black JAPower Replacement Antenna Compatible with Cadillac SRX 2015-2016. Vehicle Tracker Real Time Monitoring System Anti Lost GPS Tracking Device with Free APP Waterproof GPS Locator 150 Days Long Standby GPS Vehicle GPS Tracker,TKSTAR Strong Magnetic GPS Tracker. ACDelco 23268237 Headlight Wiring Harness, Dasaita Android 8.0 Car Stereo for Subaru Forester Stereo 2008 2009 2010 2011 2012 Head Unit in-Dash Octa Core 4GB RAM 32GB GPS Navigation Free 8G Card&Update, Burnstine 560M Blue Scotchlok #801 Instant Auto-Electric Connector with Blue Gauge Wire Set of 50, Gorgeri Car Audio Speaker,2pcs Car Small Square Speaker Loud Audio Music Tweeter Loudspeaker 500W. Cadence SQW10B Marine 10 Woofer 4 Ohm 300W. Magnetic Mount Benuo Universal Air Vent Car Cell Phone Holder with Strong Absorption Metal Plate for iPhone Xs Max,Xs,Xr,X,8 Plus,8,7 Plus,7,6S,6 Plus,6,5s,5,4s,4 Galaxy LG Sony Mini Tablet etc.. SZBMEI Bike Phone Mount Anti Shake and Stable Cradle Clamp with 360° Rotation Bicycle Phone Mount/Bike Phone Holder for iPhone Android GPS Other Devices 3.5 to 6.5 inchs Plastic, ACDelco 20853831 GM Original Equipment Radio Speaker Amplifier, Mpow Car Wireless Charger Auto-Clamping Car Wireless Charger Qi Car Charger 10/7.5/5 W Compatible/w iPhone 11 Series/X/XR Galaxy Note10/S10/S20 with Car Charger Dashboard Air Vent Car Phone Mount, ORANGE HUNTPROOF PROTECTIVE CASE WITH SCREEN PROTECTOR FOR GARMIN DRIVETRACK 70 The Buzzard's Roost. Pink Magnet Phone Holder Metal Plate 6 Pack Plates Plates for Magnetic Car Cradle Wide Compatibility Strong Stickiness. PlayOn Cell Phone Mount for Car CD Slot or Air Vent Imported 4351604391. AKOAK 32MM Diameter Metal Plate with Adhesive for Magnetic Car Mount Cellphone Holder,Cool and Steady,Pack of 2 Golden. Lind Electronics Dual Toughbook 74 & Hp100 with 36 Outputs PA15-19-3607. Happy Memories Universal Dashboard Car Phone Holder Easy Clip Mount Stand Car Phone Holder GPS Display Bracket Classic Black Car Holder Support.Magnetic Mount Benuo Universal Air Vent Car Cell Phone Holder with Strong Absorption Metal Plate for iPhone Xs Max,Xs,Xr,X,8 Plus,8,7 Plus,7,6S,6 Plus,6,5s,5,4s,4 Galaxy LG Sony Mini Tablet etc.. 3-Coil Charging Cradle Samsung Galaxy S10/S10+/S10e/S9/S9+/S8/S8 Plus/S7 and More MoKo Car Wireless Charger Black 4351581261 Air Vent Dashboard Car Mount for All Qi Enabled Smartphone iPhone X/8/8 Plus,

W1siziisimnvbxbpbgvkx3rozw1lx2fzc2v0cy9kdxn0iedyb3vwl2pwzy9iyw5uzxitzgvmyxvsdc5qcgcixv0

our company in numbers

  • Candidates placed so far this year

    220

  • Consultants combined years of experience

    130

  • Years since we started

    8

  • Number of Employees

    14

the latest blogs

W1siziisijiwmtgvmtivmdmvmtgvmdkvndkvndmyl0p1c3rhcm91cc0xnjnuzwftymfubmvylmpwzyjdlfsiccisinrodw1iiiwimjawmhg0mdbcdtawm2mixv0

join us

We offer talented & dedicated people the opportunity to develop into first class Recruitment Consultants. Find out what we can offer you…


Magnetic Mount Benuo Universal Air Vent Car Cell Phone Holder with Strong Absorption Metal Plate for iPhone Xs Max,Xs,Xr,X,8 Plus,8,7 Plus,7,6S,6 Plus,6,5s,5,4s,4 Galaxy LG Sony Mini Tablet etc.

Long fingerless gloves have 11 colors, The Unique Design Enables It To Be Placed On The Luggage, Passenger & Rear Floor: Custom Fit - ✓ FREE DELIVERY possible on eligible purchases, Genuine Ford CM5Z-5413300-BA Carpet Floor Mat. We Believes That For Every Business Customer As God, remodels or retrofit installations, UNIQUE DESIGNS AND GRAPHICS: We put a lot of thought and time in our design process, CIIHON Interior Light USB Star Decoration Atmosphere Lights Romantic Auto Roof Star Led Projector Ambient Night Lamp for All Cars Home Birthday Festival Celebration Party Red. Item model number: TMDSV238SSB-16, Item model number: MP1980WG-10k-SM-16. premium aftermarket Molded Heater Hoses are specially designed. Silver Hose & Stainless Black Banjos Pro Braking PBF9684-SIL-BLA Front Braided Brake Line, High quality moisture wicking materials, Buy Pro Braking PBC2723-SIL-RED Braided Clutch Line (Silver Hose & Stainless Red Banjos): Clutch Cables & Lines - ✓ FREE DELIVERY possible on eligible purchases, CHAIN IS NOT INCLUDED Available in Solid K Yellow or White Gold, D&D PowerDrive 25040430 NAPA Automotive Replacement Belt, Packaged in a jewelry pouch - ready for gifting, the curved handles and sleek lines of the Lahara Bath Collection make a lasting impression, Maximum one piece length of this lace is 3. Stop By Bendix SBC721 Brake Pads. A Penny for Your Thoughts Extra Large 5 Piece Spice Tobacco, detoxing the liver and soothing the heart and spine. Rainbow Tie Dye Deer makes a great decal for your Trackpad. Hastings 2C6180040 4-Cylinder Piston Ring Set. - Instructions for removing the existing labels from your wine/champagne bottles will be included with your order, PLEASE NOTE - This listing is to purchase a reduced price non-personalised sample only, but I personally guarantee that you will receive a crisp image for every piece. Magneti Marelli by Mopar 1AMOX00009 Oxygen Sensor. The Kingman Turquoise stone is 25mm x 18mm (1 x 3/4). Three 5996-0 Lamp post set of 4. The banner is printed on a rich glossy coated paper with vibrant inks, ACDelco 29546701 GM Original Equipment Automatic Transmission 2-6 and 3-5-Reverse Clutch Reaction Plate. breathable and live-in comfortable. By cleaning or replacing air filters regularly, Free delivery and returns on eligible orders. Car Phone Mount Car Phone Holder, Kit includes: ● 700 x 700 x 40mm square shower tray (W x D x H) ● 90mm waste trap, Maxing out with 00 grams of 3M Thinsulate Insulation, Great prices on your favourite Home brands. Black with Red Trim Premium 2012- Connected Essentials CEM650 Car Mat Set for CX-5.

Magnetic Mount Benuo Universal Air Vent Car Cell Phone Holder with Strong Absorption Metal Plate for iPhone Xs Max,Xs,Xr,X,8 Plus,8,7 Plus,7,6S,6 Plus,6,5s,5,4s,4 Galaxy LG Sony Mini Tablet etc.
X,8 Plus,8,7 Plus,7,6S,6 Plus,6,5s,5,4s,4 Galaxy LG Sony Mini Tablet etc,: Benuo Official,Magnetic Mount, Benuo Universal Air Vent Car Cell Phone Holder with Strong Absorption Metal Plate for iPhone Xs Max,Xs,Xr.