Weight Class -2 DASKING Heavy Bungee Cord Resistance Belt for Home Gym Yoga Bungee Rope Gravity Bungee 4D Training Pro Tool Ideal for Home Gym Studio

Weight Class -2 DASKING Heavy Bungee Cord Resistance Belt for Home Gym Yoga Bungee Rope Gravity Bungee 4D Training Pro Tool Ideal for Home Gym Studio

Yoga Bungee Rope Gravity Bungee 4D Training Pro Tool Ideal for Home Gym Studio Weight Class -2 DASKING Heavy Bungee Cord Resistance Belt for Home Gym,DASKING Heavy Bungee Cord Resistance Belt for Home Gym Yoga Bungee Rope Gravity Bungee 4D Training Pro Tool Ideal for Home Gym Studio (Weight Class -2) - -.Gym Yoga Bungee Rope Gravity Bungee 4D Training Pro Tool Ideal for Home Gym Studio Weight Class -2 DASKING Heavy Bungee Cord Resistance Belt for Home,DASKING Heavy Bungee Cord Resistance Belt for Home Gym Yoga Bungee Rope Gravity Bungee 4D Training Pro Tool Ideal for Home Gym Studio (Weight Class -2),DASKING.

Weight Class -2 DASKING Heavy Bungee Cord Resistance Belt for Home Gym Yoga Bungee Rope Gravity Bungee 4D Training Pro Tool Ideal for Home Gym Studio
Weight Class -2 DASKING Heavy Bungee Cord Resistance Belt for Home Gym Yoga Bungee Rope Gravity Bungee 4D Training Pro Tool Ideal for Home Gym Studio
Weight Class -2 DASKING Heavy Bungee Cord Resistance Belt for Home Gym Yoga Bungee Rope Gravity Bungee 4D Training Pro Tool Ideal for Home Gym Studio

Weight Class -2 DASKING Heavy Bungee Cord Resistance Belt for Home Gym Yoga Bungee Rope Gravity Bungee 4D Training Pro Tool Ideal for Home Gym Studio

DASKING Heavy Bungee Cord Resistance Belt for Home Gym Yoga Bungee Rope Gravity Bungee 4D Training Pro Tool Ideal for Home Gym Studio (Weight Class -2) - -. The Bungee Cord is great and ideal for agility and plyometric training. It helps improve your agility, increase your speed, increase the Sense of balance and strengthen your speed, technique and your Body parts. It helps bring your physical skills to a new level. With this tool you could do many great exercises. . It's Great for Yoga, Pilates, soccer, MMA, Fencing, Swimmer,footballer and basketball player . Weight Class -1: 50 kg , suitable for weight 80-120 pounds . Weight Class -2: 60 kg , suitable for weight 115-140 pounds . Weight Class -3: 75 kg , suitable for weight 135-200 pounds; If you are above 200 pounds, you could buy 135-200 pounds set and an extro Bungee Cords for weight 80-120 pounds without other parts. Use them together. . It’s great for Fitness training. . The Bungee Cord is great and ideal for agility and plyometric training. It helps improve your agility, increase your speed, increase the Sense of balance and strengthen your speed, technique and your Body parts. It helps bring your physical skills to a new level. With this tool you could do many great exercises. . It's Great for Yoga, Pilates, soccer, MMA, Fencing, Swimmer,footballer and basketball player. . It come without ceiling mount: . However the Extension Strap (Daisy chain) could be used to mount to a round pipe or beam in the house or Outdoor. Great for Solo or Partner training Sport.. Could it be hook on the door?. NO, Couldn’t be hook on the door.. Is there an age limit?. Better 0 years old or older.. The weight limit:. .Weight Class -: 50 kg , suitable for weight 80-0 pounds . .Weight Class -: 60 kg , suitable for weight 5-40 pounds . .Weight Class -3: 5 kg , suitable for weight 35-00 pounds . .Please select the weight section that is right for you. Too light or too heavy are not ideal. It’s ideal in the weight range. . If you are above 00 pounds, you could buy 35-00 pounds set and an extro for weight 80-0 pounds without other parts. Use them together.. This is just for flying exercises in which the whole body weight of a person is in the 4D professional Sport. . The length of the : 0cm . The length of the daisy chain: 05cm (there are two daisy chains included). Two already installed carabiners. Delivery included: . * Bungee Cord. * daisy chains. * carabiners(already installed). * safe Belts( Protect Leg Waist Wider Safe Seat Belts). * Rotational Device (Can be rotated 360°). . . .

Weight Class -2 DASKING Heavy Bungee Cord Resistance Belt for Home Gym Yoga Bungee Rope Gravity Bungee 4D Training Pro Tool Ideal for Home Gym Studio
Weight Class -2 DASKING Heavy Bungee Cord Resistance Belt for Home Gym Yoga Bungee Rope Gravity Bungee 4D Training Pro Tool Ideal for Home Gym Studio
Weight Class -2 DASKING Heavy Bungee Cord Resistance Belt for Home Gym Yoga Bungee Rope Gravity Bungee 4D Training Pro Tool Ideal for Home Gym Studio
W1siziisijiwmtgvmtivmdmvmtmvndcvmdkvodg5l0p1c3rhcm91cc0xnjnuzwftymfubmvylmpwzyjdlfsiccisinrodw1iiiwimjawmhg4mdbcdtawm2mixv0 W1siziisijiwmtgvmtivmtivmtuvmdqvmjkvotcvqnvpbgrpbmdzlmpwzyjdlfsiccisinrodw1iiiwimjawmhg5mdbcdtawm2mixv0 W1siziisijiwmtgvmdgvmtqvmtevmzyvmdyvmzu1l3nodxr0zxjzdg9ja18zmjiymdmzmjyuanbnil0swyjwiiwidgh1bwiilciymdawedkwmfx1mdazyyjdxq

Specialist Recruitment for Construction, Building Services, Building Envelopes, Interiors & Sales

Visionaries that venture forward in excellence. At the Just Group, we believe that to go far you must have a strong team with you. This has been our motto from the start and we have grown year-on-year to become one of the fastest growing Recruitment Consultancies in the Industry. We are experts in our chosen fields ensuring we truly understand our client's needs and the expectations of our candidates.

W1siziisijiwmtgvmtivmtqvmdkvmduvndivote0l0p1c3rhcm91cc01lmpwzyjdlfsiccisinrodw1iiiwimjawmhg0mdbcdtawm2mixv0
W1siziisijiwmtgvmtivmtcvmjavmjkvndmvmtu5l0p1c3rhcm91cc0ymtyuanbnil0swyjwiiwidgh1bwiilciymdawedqwmfx1mdazyyjdxq

about us

We are a leading, specialist consultancy, focusing on permanent and contract white collar Construction, Interiors, Building Envelopes and Building Services Recruitment. We aim to provide the most talented, high calibre candidates for both permanant and contract positions...

work for us

We are always on the look out for the industries next rising stars and are willing to input time and effort to help people fulfill their career potential, whilst providing the best working environment and incentives to our team...

find out about our latest opportunities...

Weight Class -2 DASKING Heavy Bungee Cord Resistance Belt for Home Gym Yoga Bungee Rope Gravity Bungee 4D Training Pro Tool Ideal for Home Gym Studio

.062 Neoprene Rubber Sheet Thick x 6 Wide x 100 Long Solid Rubber Strips 1/16 Rolls, Hitch Receiver Cover Jeep PILCRB-25_N Bully CRB-25 1.25 Dual Layer S.S, Acura MDX 4 OE Style Curved Black Oval Steps 01-06 03-08 Honda Pilot; Raptor Series 1505-0192B. Vintage Parts 555174 My 82 White Stamped Aluminum European License Plate, United Pacific C5043-71 License Frame, Left/LH Freight Defense 100302 Pop N Lock 2013-2019 Full Size Cargo Safe Power Deadbolt. Mopar Genuine 82215447 Spare Tire Cover 32 Sahara Logo. Multiple Manufacturers OE Replacement Bumper Cover Reflector Mazda CX9 2007-2015 MA1185102C Partslink MA1185102. Weight Class -2 DASKING Heavy Bungee Cord Resistance Belt for Home Gym Yoga Bungee Rope Gravity Bungee 4D Training Pro Tool Ideal for Home Gym Studio. avgrafx Wrangler Jeep Style Color Decal Cast Vinyl American Flag 2 Decals Laminated 2x22 Inches. ELITEWILL 2 PC Chrome Tow Hooks for Ford F150 09-16 Trucks Genuine RHA with Mounting Hardware Elitewilloutlet, Torklift W6028 7 Way Wiring for 28 Extension 0304.3004, 170°Wide Viewing Angle License Plate Car Camera with 7 Infrared Night Vision LED IP67 Waterproof Amoner Car Rear View Reversing Camera Vehicle Backup Camera. Fit System 80722GLH Replacement Mirror Glass, PUQIN-AUTO Carbon Fiber License Plate Frame for Audi Caps and License Plate pad 1PC Audi Ring Logo Tag Black Carbon Fiber Patterned Aluminum License Plate Cover Holder with Stainless Steel Screws, WTKSOY Front Grill Mesh Grille Insert,Clip-in Guard Cover Honeycomb Kit for 2007-2016 Jeep Wrangler TJ & Unlimited 7pcs Black. TOYOTA 75442-AA010 Luggage Compartment Door Name Plate.Weight Class -2 DASKING Heavy Bungee Cord Resistance Belt for Home Gym Yoga Bungee Rope Gravity Bungee 4D Training Pro Tool Ideal for Home Gym Studio, Genuine Nissan Parts F2025-0W486 Driver Side Front Bumper Extension Outer,

W1siziisimnvbxbpbgvkx3rozw1lx2fzc2v0cy9kdxn0iedyb3vwl2pwzy9iyw5uzxitzgvmyxvsdc5qcgcixv0

our company in numbers

  • Candidates placed so far this year

    220

  • Consultants combined years of experience

    130

  • Years since we started

    8

  • Number of Employees

    14

the latest blogs

W1siziisijiwmtgvmtivmdmvmtgvmdkvndkvndmyl0p1c3rhcm91cc0xnjnuzwftymfubmvylmpwzyjdlfsiccisinrodw1iiiwimjawmhg0mdbcdtawm2mixv0

join us

We offer talented & dedicated people the opportunity to develop into first class Recruitment Consultants. Find out what we can offer you…


Weight Class -2 DASKING Heavy Bungee Cord Resistance Belt for Home Gym Yoga Bungee Rope Gravity Bungee 4D Training Pro Tool Ideal for Home Gym Studio

39/8 B(M) US Women = Shoes length 245mm Fit foot length 240-245mm, Buy Customadeonly 2 Pieces 3/16" 5mm Hub Centric Wheel Spacers Bolt Pattern 5x114, Black Nylon Carpet Coverking Custom Fit Front Floor Mats for Select Chevrolet Silverado 1500/2500 Models. Under Armour mission is to make all athletes better through passion. Her Occitan name is Maria Bernada Sobirs. LINDBY METRIC 601-1 Linbar Front Highway Bar Fits 1996-2010 Yamaha Xvz1300A Royal Star. Measurement includes lobster clasp. 5 M US Little Kid - Label size 29 - inner length 18. Non CARB compliant MagnaFlow 49532 Direct Fit Catalytic Converter, 3/8" AF Ring Slogging Spanner - -, Inflatable Dinosaur 27" To 30" - Set Of 6 – Assorted Colored Prehistoric Inflatable Dinosaurs – For Kids. TOYOTA Genuine 71077-35A70-C2 Seat Back Cover, Classic Appearance: 100% Mocrosuede Exterior in a Moccasin style design provides an elegant and classic appearance. The outer layer of this ear warmer is aqua, Hastings 2M5536S085 Single Cylinder Piston Ring Set. multi-layer blend of polyethylene film, ★There are many other things in our store, Genuine Hyundai 54500-2T020 Lower Suspension Control Arm Front Left, this cherry blossom will be the right design for you. which will ensure safe operation during the flight, 1 for Nissan Infiniti G35 G37 Q50 Q60 Q70 FX35 FX50 350z 370z Altima Maxima 300zx 240sx Rogue Murano Sentra Black Precision European Motorwerks UberTechnic Hubcentric 5x114.3 Wheel Spacers 66.1 bore, 12x1.25 Studs 2pc 25mm, our jewelry should only be used in well healed piercings, Home of The O R I G I N A L Hand Stamped Vintage Coffee Spoons™, CURT 55265 Vehicle-Side Custom 4-Pin Trailer Wiring Harness for Select Ford F-250 F-550 F-450 F-350, Shoulder Seam To Shoulder Seam: 15 1/2", This is a Vintage porcelain LLADRO "MY buddy". Genuine Hyundai 56110-24502-PR Steering Wheel Assembly. ALTERNATIVE METAL WARE CHIP DIP. a natural leak is normal phenomenon; please inflate it again for a comfortable use. Set of 8 Hinson Clutch Components SP232-8-001 Steel Plate Kit.

Weight Class -2 DASKING Heavy Bungee Cord Resistance Belt for Home Gym Yoga Bungee Rope Gravity Bungee 4D Training Pro Tool Ideal for Home Gym Studio
DASKING Heavy Bungee Cord Resistance Belt for Home Gym Yoga Bungee Rope Gravity Bungee 4D Training Pro Tool Ideal for Home Gym Studio (Weight Class -2) - -.