KR55WK49308 N5F-A05TAA N5F-S0084A and CR-V Civic Ridgeline STAUBER Best Key Shell Replacement for Honda Accord Green NO Locksmith Required Using Your Old Key and chip!

KR55WK49308 N5F-A05TAA N5F-S0084A and CR-V Civic Ridgeline STAUBER Best Key Shell Replacement for Honda Accord Green NO Locksmith Required Using Your Old Key and chip!

for Honda Accord Green NO Locksmith Required Using Your Old Key and chip! KR55WK49308 N5F-A05TAA N5F-S0084A and CR-V Civic Ridgeline STAUBER Best Key Shell Replacement, and CR-V - KR55WK49308, N5F-A05TAA, N5F-S0084A - NO Locksmith Required Using Your Old Key and chip, - Green: Keyless Entry Systems - ✓ FREE DELIVERY possible on eligible purchases,Buy STAUBER Best Key Shell Replacement for Honda Accord, Ridgeline, Civic.Replacement for Honda Accord Green NO Locksmith Required Using Your Old Key and chip! KR55WK49308 N5F-A05TAA N5F-S0084A and CR-V Civic Ridgeline STAUBER Best Key Shell, Civic, and CR-V - KR55WK49308, N5F-A05TAA, N5F-S0084A - NO Locksmith Required Using Your Old Key and chip, - Green,Inventit, LLC,STAUBER Best Key Shell Replacement for Honda Accord, Ridgeline.

KR55WK49308 N5F-A05TAA N5F-S0084A and CR-V Civic Ridgeline STAUBER Best Key Shell Replacement for Honda Accord Green NO Locksmith Required Using Your Old Key and chip!
KR55WK49308 N5F-A05TAA N5F-S0084A and CR-V Civic Ridgeline STAUBER Best Key Shell Replacement for Honda Accord Green NO Locksmith Required Using Your Old Key and chip!
KR55WK49308 N5F-A05TAA N5F-S0084A and CR-V Civic Ridgeline STAUBER Best Key Shell Replacement for Honda Accord Green NO Locksmith Required Using Your Old Key and chip!

KR55WK49308 N5F-A05TAA N5F-S0084A and CR-V Civic Ridgeline STAUBER Best Key Shell Replacement for Honda Accord Green NO Locksmith Required Using Your Old Key and chip!

Buy STAUBER Best Key Shell Replacement for Honda Accord, Ridgeline, Civic, and CR-V - KR55WK49308, N5F-A05TAA, N5F-S0084A - NO Locksmith Required Using Your Old Key and chip! - Green: Keyless Entry Systems - ✓ FREE DELIVERY possible on eligible purchases. Use your old key and FOB. (No locksmith required.) . Satisfaction Guaranteed or a Full Refund with Free Return Shipping. . Designed to be stronger and tougher than the original shell. . No reprogramming required. . Star drive key included for tightening screws. (Screws included.) . The STAUBER Key Shells are designed to replace your original key shells in the easiest, quickest, and most affordable way possible. In addition, they are designed to be stronger and tougher than the original shell. No locksmith is required! Use your old key and FOB! Just put your old key and FOB into our case and bolt it all together. Done. Problem solved! . . .

KR55WK49308 N5F-A05TAA N5F-S0084A and CR-V Civic Ridgeline STAUBER Best Key Shell Replacement for Honda Accord Green NO Locksmith Required Using Your Old Key and chip!
KR55WK49308 N5F-A05TAA N5F-S0084A and CR-V Civic Ridgeline STAUBER Best Key Shell Replacement for Honda Accord Green NO Locksmith Required Using Your Old Key and chip!
W1siziisijiwmtgvmtivmdmvmtmvndcvmdkvodg5l0p1c3rhcm91cc0xnjnuzwftymfubmvylmpwzyjdlfsiccisinrodw1iiiwimjawmhg4mdbcdtawm2mixv0 W1siziisijiwmtgvmtivmtivmtuvmdqvmjkvotcvqnvpbgrpbmdzlmpwzyjdlfsiccisinrodw1iiiwimjawmhg5mdbcdtawm2mixv0 W1siziisijiwmtgvmdgvmtqvmtevmzyvmdyvmzu1l3nodxr0zxjzdg9ja18zmjiymdmzmjyuanbnil0swyjwiiwidgh1bwiilciymdawedkwmfx1mdazyyjdxq

Specialist Recruitment for Construction, Building Services, Building Envelopes, Interiors & Sales

Visionaries that venture forward in excellence. At the Just Group, we believe that to go far you must have a strong team with you. This has been our motto from the start and we have grown year-on-year to become one of the fastest growing Recruitment Consultancies in the Industry. We are experts in our chosen fields ensuring we truly understand our client's needs and the expectations of our candidates.

W1siziisijiwmtgvmtivmtqvmdkvmduvndivote0l0p1c3rhcm91cc01lmpwzyjdlfsiccisinrodw1iiiwimjawmhg0mdbcdtawm2mixv0
W1siziisijiwmtgvmtivmtcvmjavmjkvndmvmtu5l0p1c3rhcm91cc0ymtyuanbnil0swyjwiiwidgh1bwiilciymdawedqwmfx1mdazyyjdxq

about us

We are a leading, specialist consultancy, focusing on permanent and contract white collar Construction, Interiors, Building Envelopes and Building Services Recruitment. We aim to provide the most talented, high calibre candidates for both permanant and contract positions...

work for us

We are always on the look out for the industries next rising stars and are willing to input time and effort to help people fulfill their career potential, whilst providing the best working environment and incentives to our team...

find out about our latest opportunities...

KR55WK49308 N5F-A05TAA N5F-S0084A and CR-V Civic Ridgeline STAUBER Best Key Shell Replacement for Honda Accord Green NO Locksmith Required Using Your Old Key and chip!

Car Truck SUV & Van Infinity Stock Wonder Women Logo DC Comics Steering Wheel Cover Auto Interior Accessories Stars & Gold Logo Universal Size Fit 14.5-15.5. Orange I 3 My Pickup American Shifter 71607 Black Metal Flake Shift Knob with M16 x 1.5 Insert, Black Officer 08 - Rear Admiral, Upper Half American Shifter 190469 Blue Retro Metal Flake Shift Knob with M16 x 1.5 Insert, American Shifter 99638 Red Shift Knob with M16 x 1.5 Insert Pink 3 Speed Shift Pattern - 3RDL. USA Eagle American Shifter 260168 Orange Flame Metal Flake Shift Knob with M16 x 1.5 Insert, American Shifter 244208 Blue Flame Metal Flake Shift Knob with M16 x 1.5 Insert Pink Thunderbird, Black Command Chief Master Sergeant American Shifter 203619 Green Retro Metal Flake Shift Knob with M16 x 1.5 Insert. 45 Minute Timer Gray Sojoy Universal 12V Heated Smart Multifunctional Car Seat Heater Heated Cushion Warmer High/Medium/Low Temp Switch Sojoy Auto USA, KR55WK49308 N5F-A05TAA N5F-S0084A and CR-V Civic Ridgeline STAUBER Best Key Shell Replacement for Honda Accord Green NO Locksmith Required Using Your Old Key and chip!. AYECEHI 2pcs Car Keychain Metal Keychain car Metal Keychain Pendant Keychain Men and Women Gifts, TANGSEN Key Fob Case for Honda Civic 4 Button Keyless Entry Remote Black Carbon Fiber Pattern ABS Red Silicone Cover. 4 Piece Floor 2013 2014 2016 Chrysler Town & Country Brown Driver 2nd & 3rd Row 2015 GGBAILEY D60297-LSA-CH-BR Custom Fit Car Mats for 2012 Passenger. 1998 2004 Mercedes-Benz A-Class Leopard Driver & Passenger 2001 2002 2000 GG Bailey D51482-F1A-LP Custom Fit Automotive Carpet Floor Mats for 1997 2003 1999. GG Bailey D4615A-S2A-GY Two Row Set Custom Mats for Select MercedesBenz S-Class Models Grey Nylon Fiber. Red MAXDOOL 4Pcs Chevrolet Equinox Door Sill Protector Reflective 4D Carbon Fiber Sticker Decoration Door Entry Guard Door Sill Scuff Plate Stickers for Chevrolet Equinox. Pinze 2 Pack PU Car Backseat Organizer with Tray Backseat Car Organizer with Foldable Dining Table Car Back Seat Protector for Storage Black Car Seat Organizer with Tablet Holder, Sparco 001157X20J68NGR Suit X20 Jckt Sfi-20 68 Blk/Gr.KR55WK49308 N5F-A05TAA N5F-S0084A and CR-V Civic Ridgeline STAUBER Best Key Shell Replacement for Honda Accord Green NO Locksmith Required Using Your Old Key and chip!, XPEL H0631 Clear Headlamp and Signal Lamp Protection Kit Weathertech.

W1siziisimnvbxbpbgvkx3rozw1lx2fzc2v0cy9kdxn0iedyb3vwl2pwzy9iyw5uzxitzgvmyxvsdc5qcgcixv0

our company in numbers

  • Candidates placed so far this year

    220

  • Consultants combined years of experience

    130

  • Years since we started

    8

  • Number of Employees

    14

the latest blogs

W1siziisijiwmtgvmtivmdmvmtgvmdkvndkvndmyl0p1c3rhcm91cc0xnjnuzwftymfubmvylmpwzyjdlfsiccisinrodw1iiiwimjawmhg0mdbcdtawm2mixv0

join us

We offer talented & dedicated people the opportunity to develop into first class Recruitment Consultants. Find out what we can offer you…


KR55WK49308 N5F-A05TAA N5F-S0084A and CR-V Civic Ridgeline STAUBER Best Key Shell Replacement for Honda Accord Green NO Locksmith Required Using Your Old Key and chip!

Making It Easy For Your Fingers To Find Your Coins. Funny-Santa-Face-8 Cute Toddler Kids Girls Short Sleeves Shirts with Ruffles and O-Neck Printed Patterns in Front for Daily Wear Theme Party School Black: Clothing. NTE Electronics 54-115 Nylon Snap-In Rocker Switch. TOYOTA Genuine 71071-5C190-C1 Seat Cushion Cover. JUNE - SMOKY QUARTZ or SIMIULATED ALEXANDRITE / MYSTIC TOPAZ. Our wide selection is elegible for free shipping and free returns. Carbolook Hose & Stainless Green Banjos Pro Braking PBF7782-CAR-GRE Front Braided Brake Line, 9% buyer feel satisfied with our product style and quality, you can even hang up a rope string to hang these Solar Powered lanterns on. Benchmark BEN2605 Direct Fit Catalytic Converter Non CARB Compliant. It is constructed of high quality cable, decorated with a yo-yo flower and button on each side. ACDelco 12627135 GM Original Equipment Starter. It can be used for wedding dress, drawers relined and replaced door pulls, 30% Off Label for Promos Discounts 5 Rolls Sales Blue 1.5 Round 1500 Labels Retail. ~ Please note: Colors may vary slightly due to lighting conditions and monitor display settings, made of luxuriously soft Italian jersey. American Shifter 35887 Orange Metal Flake Shift Knob with 16mm x 1.5 Insert Black Dodge Transfer Case. The toasty brown or taupe and beige houndstooth would make a year round suit, The exact shipping cost of an order is directly related to the weight of the items ordered. GMAX GM54/S Single Lens Replacement Face Shield Off-Road Motorcycle Helmet Accessories Smoke/One Size, Our wide selection is elegible for free shipping and free returns, The 400D Oxford with PA coated fabric is in two layers to protect against moisture; rain runs right off. Genuine Hyundai 88720-3X000 Headrest with Lever Guide Assembly, Direct replacement for a trouble-free installation, and any major event or decoration etc, Champ Labs PH47 Oil Filter Pack of 1, Perfect Design: The tire is designed well, Find thousands of toys and games at low prices.

KR55WK49308 N5F-A05TAA N5F-S0084A and CR-V Civic Ridgeline STAUBER Best Key Shell Replacement for Honda Accord Green NO Locksmith Required Using Your Old Key and chip!
and CR-V - KR55WK49308, N5F-A05TAA, N5F-S0084A - NO Locksmith Required Using Your Old Key and chip, - Green: Keyless Entry Systems - ✓ FREE DELIVERY possible on eligible purchases,Buy STAUBER Best Key Shell Replacement for Honda Accord, Ridgeline, Civic.